DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and Acox2

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_665713.2 Gene:Acox2 / 252898 RGDID:628684 Length:681 Species:Rattus norvegicus


Alignment Length:416 Identity:92/416 - (22%)
Similarity:149/416 - (35%) Gaps:105/416 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 REELYPAEQVRRLGELGLMSVTVREEYGGSGLDYQAYAIGMEE----------VARGDAAVSIVM 119
            |||||.....:|.                 .|:..|:::|..|          |..|:..:|:  
  Rat    73 REELYEDAIQKRF-----------------HLEKLAWSLGWSEDGPERIYANRVLDGNVNLSL-- 118

  Fly   120 GVNNLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQG-------D 177
              :.:.:.|::..|:::|...:.......:.|..||.:|.|:|:......|.|....       .
  Rat   119 --HGVAMNAIRSLGSDEQIAKWGQLCKNFQIITTYAQTELGHGTYLQGLETEATYDEARQEFVIH 181

  Fly   178 SYQINGTKAWISN-SKEASGGIVFATVDKSMKHKGITAFLTP-------KDVPGLSIAKKESKMG 234
            |..:..||.|..: ....:..:|.|.:.......|:.||:.|       ..:||:::.....|||
  Rat   182 SPTMTSTKWWPGDLGWSVTHAVVLAQLTCLGVRHGMHAFIVPIRSLEDHTPLPGITVGDIGPKMG 246

  Fly   235 MRATSTCQLVLEDVHVPR----SRVLGAAGDGFKIAMQSLDCGRIG-----IAAQATGI---AQA 287
            :.......|.|..|.|||    ||......||....:.:.....:|     :.....||   .|.
  Rat   247 LEHIDNGFLQLNHVRVPRENMLSRFAEVLPDGTYQRLGTPQSNYLGMLVTRVQLLCKGILPSLQK 311

  Fly   288 ALELAVDYSQKRVAFGKHLARL------------QLIQQKL--------ADMATRVEISRLL--T 330
            |..:|..||..|     |.:||            |..||||        |...|...:|...  :
  Rat   312 ACIIATRYSVIR-----HQSRLRPSDPEAKILEYQTQQQKLLPQLAVSYAFHFTATSLSEFFHSS 371

  Fly   331 WRAAWLKDNGLPITKEAAMAKLHASES------ATFCAHQ---CIQILGGMGYT--TDLPAELYY 384
            :.|...:|..|       :.:|||..:      |.|||..   |.:..||.||:  :.||..:..
  Rat   372 YSAILKRDFSL-------LPELHALSTGMKATFADFCAQGAEICRRACGGHGYSKLSGLPTLVAR 429

  Fly   385 RNARVTEIYEGTSEIQRIVIANAVLR 410
            ..|..|  |||.:.:..:.:|..:::
  Rat   430 ATASCT--YEGENTVLYLQVARFLMK 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 92/416 (22%)
SCAD_SBCAD 39..410 CDD:173847 92/414 (22%)
Acox2NP_665713.2 AXO 20..655 CDD:173839 92/416 (22%)
Microbody targeting signal. /evidence=ECO:0000255 679..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.