DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and acdh-4

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001300435.1 Gene:acdh-4 / 172367 WormBaseID:WBGene00020419 Length:385 Species:Caenorhabditis elegans


Alignment Length:324 Identity:138/324 - (42%)
Similarity:201/324 - (62%) Gaps:4/324 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LAALSETHQILQKTCREFANAELAPKARHHDR-EELYPAEQVRRLGELGLMSVTVREEYGGSGLD 97
            |..|||......||.|:||:..:.|..|..|| .|:.|| .:....|.|||.:.|.|:|||.|..
 Worm    38 LQVLSEQETGFVKTVRQFADTVIKPLVREMDRTSEMTPA-VINGCFENGLMGIEVPEKYGGPGAT 101

  Fly    98 YQAYAIGMEEVARGDAAVSIVMGVNN-LYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGN 161
            :...|:.:||:::.||:|..::.|:| |::..:.:.|||:||:.:| |......:..:||||.|:
 Worm   102 FFDAALVIEEISKVDASVGAMVDVHNTLFIPLIIELGTEKQKEKYL-PKCYTSSVGSFALSETGS 165

  Fly   162 GSDAGAASTTAKLQGDSYQINGTKAWISNSKEASGGIVFATVDKSMKHKGITAFLTPKDVPGLSI 226
            ||||.|..||||..||.|.|||:|.|||||:::...:|||..|.|..:||||.|:..|...|.:|
 Worm   166 GSDAFALKTTAKKDGDDYVINGSKMWISNSEQSETFLVFANADPSKGYKGITCFIVEKGTKGFTI 230

  Fly   227 AKKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGDGFKIAMQSLDCGRIGIAAQATGIAQAALEL 291
            .|.|.|:|:|::|||.|..::|.|.:|.:||..|.|:|.|::.|:.|||||.||..|:||...:.
 Worm   231 GKHEDKLGVRSSSTCPLHFDNVRVHKSAILGEFGKGYKYAIEYLNAGRIGIGAQMLGLAQGCFDQ 295

  Fly   292 AVDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWRAAWLKDNGLPITKEAAMAKLHAS 355
            .:.|.|:|..||:.:...|.:|.::|.:.|.:|.:|||.:.||.:|.:|||..:|||||||.||
 Worm   296 TIPYLQQREQFGQRIIDFQGMQHQIAQVRTEIEAARLLVYNAARMKQHGLPFVREAAMAKLFAS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 137/321 (43%)
SCAD_SBCAD 39..410 CDD:173847 135/319 (42%)
acdh-4NP_001300435.1 CaiA 41..359 CDD:224871 135/319 (42%)
ACAD 43..359 CDD:299127 133/317 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1951
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 1 1.000 - - FOG0000508
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102170
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.670

Return to query results.
Submit another query.