DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4860 and LOC100037342

DIOPT Version :9

Sequence 1:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_009296680.1 Gene:LOC100037342 / 100037342 -ID:- Length:323 Species:Danio rerio


Alignment Length:339 Identity:121/339 - (35%)
Similarity:197/339 - (58%) Gaps:25/339 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 MSVTVREEYGGSGLDYQAYAIGMEEVARGDAAVSIVMGVNNLYLGA-VQQHGTEQQKQDFLVPYT 146
            |.:.:..||||||..:.:..:.:||:|:.||:|:::..:.|..:.. :.|.||..||:.:| |..
Zfish     1 MGMEIGSEYGGSGCSFFSSVLVIEELAKVDASVAVLCDIQNTLINTLMMQLGTHTQKEKYL-PRL 64

  Fly   147 QGEHIAFYALSEPGNGSDAGAASTTAKLQGDSYQINGTKAWISNSKEASGGIVFATVDKSMKHKG 211
            ..:.:..:.|||...||||.:..|.|:...|.:.|||:|.||||::.|...:|.|..:.:..::|
Zfish    65 ASDMVGSFCLSEAEAGSDAFSLRTQAQKHKDYFIINGSKMWISNAEHAGVFLVMANAEPAAGYRG 129

  Fly   212 ITAFLTPKDVPGLSIAKKESKMGMRATSTCQLVLEDV-------HVPRSRVLGAAGDGFKIAMQS 269
            ||.|:..:|..||.|.:||:|:|:||:|||.|..:::       |.|             ..:..
Zfish   130 ITCFIVDRDTEGLHIGRKENKLGLRASSTCPLTFDNMKVMHTHTHTP-------------TPIPD 181

  Fly   270 LDCGRIGIAAQATGIAQAALELAVDYSQKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWRAA 334
            |   |:.:.||..|:||...:..|.|:::||.|||.:...|.:|.::|.:||::|.:||||:.||
Zfish   182 L---RVCVCAQMLGLAQGCFDQTVPYTRQRVQFGKRIFDFQGMQHQIAHVATQLEAARLLTYNAA 243

  Fly   335 WLKDNGLPITKEAAMAKLHASESATFCAHQCIQILGGMGYTTDLPAELYYRNARVTEIYEGTSEI 399
            .||:.|.|..|||.|||.:::|.|:....:|::.:||:|:|.|.|.|.|||:.::..|||||:.|
Zfish   244 RLKEAGRPYIKEACMAKYYSAEVASLTTSKCLEWMGGVGFTKDYPIEKYYRDCKIGTIYEGTTNI 308

  Fly   400 QRIVIANAVLRELG 413
            |...:|..:.:|.|
Zfish   309 QLSTMAKMIDQEYG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4860NP_650163.2 CaiA 37..414 CDD:224871 121/339 (36%)
SCAD_SBCAD 39..410 CDD:173847 119/334 (36%)
LOC100037342XP_009296680.1 ACAD 1..318 CDD:299127 119/333 (36%)
CaiA 1..317 CDD:224871 119/332 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.