DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4830 and acsbg1

DIOPT Version :9

Sequence 1:NP_650160.1 Gene:CG4830 / 41477 FlyBaseID:FBgn0037996 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001121495.1 Gene:acsbg1 / 100158596 XenbaseID:XB-GENE-985321 Length:254 Species:Xenopus tropicalis


Alignment Length:187 Identity:40/187 - (21%)
Similarity:63/187 - (33%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VTFGQALTWAIRIAQQLKSRGLDHKDIIGISARNTTYIMPTAVACFFHGTPFQSANPILEESTLK 120
            |||........:.|:.....||:....:||...|:.....:|:...|.|            ..:.
 Frog    74 VTFMDYYKLCRQAAKSFLKLGLERFHSVGILGFNSEEWFISAIGTVFAG------------GIIT 126

  Fly   121 HLYNISKPKIIFTDADHYDKLYSATSAFKPEIILTTGTK--DGVLSIQDLLAPTKTEFFYQPTPL 183
            .:|..:.|     :|.||     ..|..|..||:....|  :.:|.|.|.|...|....|:....
 Frog   127 GIYTTNSP-----EACHY-----VASDCKMNIIVVENQKQLEKILQIWDGLPHLKAVVQYKGNLQ 181

  Fly   184 KEGP-----------------------------SQTVAILTSSGTTGMPKAVCISND 211
            ::.|                             :|...::.:|||||.||.|.:|:|
 Frog   182 EKRPNLYTWEEFMEFGKDIADAHLDDIINSQKANQCCVLIYTSGTTGNPKGVMLSHD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4830NP_650160.1 CaiC 18..529 CDD:223395 40/187 (21%)
AFD_class_I 46..518 CDD:302604 40/187 (21%)
acsbg1NP_001121495.1 AFD_class_I 66..>240 CDD:302604 40/187 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.