| Sequence 1: | NP_731676.2 | Gene: | Adk1 / 41476 | FlyBaseID: | FBgn0037995 | Length: | 396 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650837.1 | Gene: | CG4686 / 42361 | FlyBaseID: | FBgn0038739 | Length: | 181 | Species: | Drosophila melanogaster |
| Alignment Length: | 41 | Identity: | 10/41 - (24%) |
|---|---|---|---|
| Similarity: | 16/41 - (39%) | Gaps: | 3/41 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 IKSFRLFRRTPIHPPAFQHFSGGVFRTSFRSFCDCQEHRRM 50 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Adk1 | NP_731676.2 | adenosine_kinase | 54..382 | CDD:238573 | |
| CG4686 | NP_650837.1 | ribokinase_pfkB_like | <24..114 | CDD:469648 | |
| DUF423 | 85..169 | CDD:461234 | 10/41 (24%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||