DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and CG4686

DIOPT Version :10

Sequence 1:NP_731676.2 Gene:Adk1 / 41476 FlyBaseID:FBgn0037995 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_650837.1 Gene:CG4686 / 42361 FlyBaseID:FBgn0038739 Length:181 Species:Drosophila melanogaster


Alignment Length:41 Identity:10/41 - (24%)
Similarity:16/41 - (39%) Gaps:3/41 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IKSFRLFRRTPIHPPAFQHFSGGVFRTSFRSFCDCQEHRRM 50
            :.||.:......|.|.   |:|.:..|....|..|..:|.:
  Fly   118 LHSFAMMAMPLAHYPV---FTGTLMITGMMLFSGCMYYRAL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_731676.2 adenosine_kinase 54..382 CDD:238573
CG4686NP_650837.1 ribokinase_pfkB_like <24..114 CDD:469648
DUF423 85..169 CDD:461234 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.