DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn and FCGBP

DIOPT Version :9

Sequence 1:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster
Sequence 2:NP_003881.2 Gene:FCGBP / 8857 HGNCID:13572 Length:5405 Species:Homo sapiens


Alignment Length:444 Identity:95/444 - (21%)
Similarity:159/444 - (35%) Gaps:98/444 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VAASAPTPAAVTPVVSPVIATPPVVPANTTVPVAAPVAAVPAAVPVVAPVL---APAVAPAVAPV 202
            :::.:.:||:|: ::|....|...|   |..|..:.:..:.|...::...:   |..:....|..
Human    57 ISSLSESPASVS-ILSQADNTSKKV---TVRPGESVMVNISAKAEMIGSKIFQHAVVIHSDYAIS 117

  Fly   203 VAETPAPPPVAEIPVATIPECVAPLIPEVSVVATKPLAA--AEPVVVAPPAT------ETPVVAP 259
            |....|.|..||:.:                  .:|:.|  .|..|:.||.|      |..|||.
Human   118 VQALNAKPDTAELTL------------------LRPIQALGTEYFVLTPPGTSARNVKEFAVVAG 164

  Fly   260 AAASPHVSVAPAVETAV--------VAPVSASTEPPVAAATLTTAPETPALAPVVAESQVAANTV 316
            ||.:   ||:..::.:|        ...|...|..|...|.|.::.:       ::.|:|.|::.
Human   165 AAGA---SVSVTLKGSVTFNGKFYPAGDVLRVTLQPYNVAQLQSSVD-------LSGSKVTASSP 219

  Fly   317 VATPPTPAPEPETIAPPVVAETPEVASVAVAETTPP-------VVPPVAAES--IPAPVVATTPV 372
            ||          .::....|:.....:..|.:..|.       |||.:|::|  ..|.|||:   
Human   220 VA----------VLSGHSCAQKHTTCNHVVEQLLPTSAWGTHYVVPTLASQSRYDLAFVVAS--- 271

  Fly   373 PAT-LAVTDPDVTASAVPELPPVIAPSPVPSAVAETPVDLAPPVLPPVAAEPVPAVVAEETPETP 436
            .|| |......:|.|...:...|:.....||    .|:.|:..|...|......|:..|.|.:  
Human   272 QATKLTYNHGGITGSRGLQAGDVVEFEVRPS----WPLYLSANVGIQVLLFGTGAIRNEVTYD-- 330

  Fly   437 APASAPVTIAALDIPEVAPVIAAPSDAPAEAPSAAAPIVSTPPTTASVPETTAPPAAVPTEPIDV 501
                 |..:...|:....|.....|....|  ..|..:..|...:....:..|..|.:..|.:..
Human   331 -----PYLVLIPDVAAYCPAYVVKSVPGCE--GVALVVAQTKAISGLTIDGHAVGAKLTWEAVPG 388

  Fly   502 SVLSEAAIETPVAPPV---EVTTEVAVADVAPPEA-----AAD---LIIEPVEP 544
            |..|.|.:|...|..:   |.||.:.:......:|     |||   .::.||||
Human   389 SEFSYAEVELGTADMIHTAEATTNLGLLTFGLAKAIGYATAADCGRTVLSPVEP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CpnNP_731674.1 rne <9..167 CDD:236766 6/25 (24%)
rne <109..300 CDD:236766 37/177 (21%)
rne <228..409 CDD:236766 46/206 (22%)
rne <331..594 CDD:236766 53/235 (23%)
rne <501..763 CDD:236766 16/55 (29%)
FCGBPNP_003881.2 IgGFc-binding 24..450 95/444 (21%)
VWD 472..627 CDD:278521
C8 667..742 CDD:214843
TIL 745..799 CDD:280072
VWD 864..1019 CDD:278521
C8 1060..1133 CDD:214843
TIL 1136..1189 CDD:280072
VWC 1194..1245 CDD:302663
VWD 1252..1407 CDD:278521
C8 1454..1529 CDD:214843
TIL 1532..1585 CDD:280072
VWC 1587..1640 CDD:302663
VWD 1673..1832 CDD:278521
C8 1871..1946 CDD:214843
TIL 1950..2004 CDD:280072
VWD 2072..2222 CDD:278521
C8 2260..2334 CDD:214843
TIL 2337..2390 CDD:280072
VWC 2398..2446 CDD:302663
VWD 2453..2608 CDD:278521
C8 2655..2730 CDD:214843
TIL 2733..2786 CDD:280072
VWC 2788..2841 CDD:302663
VWD 2874..3033 CDD:278521
C8 3072..3147 CDD:214843
TIL 3151..3205 CDD:280072
VWD 3273..3423 CDD:278521
C8 3461..3535 CDD:214843
TIL 3538..3591 CDD:280072
VWC 3599..3647 CDD:302663
VWD 3654..3809 CDD:278521
C8 3856..3931 CDD:214843
TIL 3934..3987 CDD:280072
VWC 3989..4042 CDD:302663
VWD 4075..4234 CDD:278521
C8 4273..4348 CDD:214843
TIL 4352..4406 CDD:280072
VWD 4474..4624 CDD:278521
C8 4662..4736 CDD:214843
TIL 4739..4792 CDD:280072
VWC 4797..4849 CDD:302663
VWD 4856..5003 CDD:278521
C8 5044..5118 CDD:214843
TIL 5121..5174 CDD:280072
VWD 5235..5382 CDD:295339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.