DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn and Vit

DIOPT Version :9

Sequence 1:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster
Sequence 2:NP_083089.1 Gene:Vit / 74199 MGIID:1921449 Length:650 Species:Mus musculus


Alignment Length:346 Identity:70/346 - (20%)
Similarity:105/346 - (30%) Gaps:145/346 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 STSSPIPETSLPPPNEAVASPEVAVAPITAPEPIPEPEPSLATP---TEPIPVEAPVVIQEAVDA 627
            |.|:.:...|||...|:....|            .:|:..:|.|   |......|.....|...|
Mouse   116 SYSNGVQSLSLPRWRESFIVAE------------SKPQKGVAYPSTLTYSSSKTAAAKAGETTKA 168

  Fly   628 VEVPVTETSTSIPETTVEYPVAEKVLDPAITEAPVTTQEPDVANINDGAPATEITTPAVEIVTAA 692
            .|.|      |||.||:: ||       .:|:|..|             |..|:|..:.....||
Mouse   169 YEKP------SIPGTTIQ-PV-------TLTQAQAT-------------PVAEVTHRSTSKPFAA 206

  Fly   693 AEVSDTAIPLIDPPVPQEIA--VAEIPETE-TKPAEVIVEQSTIPIEAPVPEVS-KYAEPVISEA 753
            :        :.:.|.||.:.  ..|:.|.: .||..|:::...:|.|    |:| :.:|||....
Mouse   207 S--------VTNSPRPQPVGHRSQEMEEVDGWKPGPVLLDSGFVPKE----ELSTQSSEPVPQGD 259

  Fly   754 PAAEVPIT-----------------------------------------AGDNP----------- 766
            |..::.::                                         .||||           
Mouse   260 PNCKIDLSFLIDGSTSIGKRRFRIQKQFLADVVQALDIGPAGPLVGVVQYGDNPATQFNLKTHMN 324

  Fly   767 -----------------DNTSVGISEVVPTIAEKA--------------VEEVPTSEIPEQSSSP 800
                             .|....||.|..|...||              |:..||.::.|.|...
Mouse   325 SQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPTDKVEEVSRVA 389

  Fly   801 SDS-VPVAKIT---PLLRDLQ 817
            .:| :.|..||   ...||:|
Mouse   390 RESGINVFFITVEGAAERDIQ 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CpnNP_731674.1 rne <9..167 CDD:236766
rne <109..300 CDD:236766
rne <228..409 CDD:236766
rne <331..594 CDD:236766 7/27 (26%)
rne <501..763 CDD:236766 47/244 (19%)
VitNP_083089.1 LCCL 44..133 CDD:281766 6/16 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..226 6/35 (17%)
vWFA 265..428 CDD:294047 23/146 (16%)
vWA_collagen 466..626 CDD:238749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.