DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cpn and TECTA

DIOPT Version :9

Sequence 1:	NP_731674.1	Gene:	Cpn / 41474	FlyBaseID:	FBgn0261714	Length:	864	Species:	Drosophila melanogaster
Sequence 2:	NP_005413.2	Gene:	TECTA / 7007	HGNCID:	11720	Length:	2155	Species:	Homo sapiens

Alignment Length:	73	Identity:	16/73 - (21%)
Similarity:	26/73 - (35%)	Gaps:	10/73 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   537 LIIEPVEPPAPIPDLLEQTTSVPAVEAAESTSSP---------IPETSLPPPNEAVASPEVAVAP 592
            |:....:|...:....:..|..|.|:...|:...         :|..::...|..|.|..|.|:.
Human    17 LVQHQAQPRELMYPFWQNDTKTPKVDDGSSSEIKLAIPVFFFGVPYRTVYVNNNGVVSFNVLVSQ 81

  Fly   593 ITAPEPIP 600
            .| ||..|
Human    82 FT-PESFP 88

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cpn	NP_731674.1	rne	<9..167	CDD:236766
		rne	<109..300	CDD:236766
		rne	<228..409	CDD:236766
		rne	<331..594	CDD:236766	12/65 (18%)
		rne	<501..763	CDD:236766	16/73 (22%)
TECTA	NP_005413.2	NIDO	98..254	CDD:214712
		VWD	322..478	CDD:278521
		C8	517..591	CDD:214843
		TIL	597..650	CDD:280072
		VWC	652..706	CDD:302663
		VWD	703..865	CDD:214566
		C8	905..981	CDD:214843
		TIL	984..1036	CDD:280072
		VWD	1100..1258	CDD:278521
		C8	1298..1368	CDD:285899
		TIL	1372..1425	CDD:280072
		VWD	1487..1639	CDD:278521
		C8	1684..1757	CDD:214843
		ZP	1805..2057	CDD:214579
		Zona_pellucida	1937..2057	CDD:278526
		FXa_inhibition	2089..2121	CDD:291342
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1216
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900