powered by:
Protein Alignment Cpn and TECTA
DIOPT Version :9
Sequence 1: | NP_731674.1 |
Gene: | Cpn / 41474 |
FlyBaseID: | FBgn0261714 |
Length: | 864 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_005413.2 |
Gene: | TECTA / 7007 |
HGNCID: | 11720 |
Length: | 2155 |
Species: | Homo sapiens |
Alignment Length: | 73 |
Identity: | 16/73 - (21%) |
Similarity: | 26/73 - (35%) |
Gaps: | 10/73 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 537 LIIEPVEPPAPIPDLLEQTTSVPAVEAAESTSSP---------IPETSLPPPNEAVASPEVAVAP 592
|:....:|...:....:..|..|.|:...|:... :|..::...|..|.|..|.|:.
Human 17 LVQHQAQPRELMYPFWQNDTKTPKVDDGSSSEIKLAIPVFFFGVPYRTVYVNNNGVVSFNVLVSQ 81
Fly 593 ITAPEPIP 600
.| ||..|
Human 82 FT-PESFP 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1216 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.