DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn and tecta

DIOPT Version :9

Sequence 1:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster
Sequence 2:XP_009300199.1 Gene:tecta / 561355 ZFINID:ZDB-GENE-110411-120 Length:2201 Species:Danio rerio


Alignment Length:152 Identity:29/152 - (19%)
Similarity:48/152 - (31%) Gaps:53/152 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 NEAVASPEVAVAPITAPEPIPEPE--------PSLAT---PTEPIPVEAPVVIQEAVDAVEVPVT 633
            |::....||..|.:......|..|        ..|||   .|.|.|.|:...:.:.:..:...| 
Zfish   693 NDSCGEGEVCAAEVGLLGCYPRREAICSLSQSQILATFDGSTMPFPDESSFYLVKTLGRLPANV- 756

  Fly   634 ETSTSIPETTVEYPVAEKVLDPAIT------------EAPVTTQEPDVANINDGAPATEITTPAV 686
                    |:||..:..|:::...|            ||.:...:.|:..:| |.||        
Zfish   757 --------TSVEVKIGRKLVNKGPTWLRPVVVRVGHLEAQIGGSDFDLIKVN-GEPA-------- 804

  Fly   687 EIVTAAAEVSDTAIPLIDPPVP 708
                        .:|.:.|..|
Zfish   805 ------------IVPYVHPVEP 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CpnNP_731674.1 rne <9..167 CDD:236766
rne <109..300 CDD:236766
rne <228..409 CDD:236766
rne <331..594 CDD:236766 4/13 (31%)
rne <501..763 CDD:236766 29/152 (19%)
tectaXP_009300199.1 NIDO 100..256 CDD:214712
VWD 324..480 CDD:278521
C8 519..594 CDD:214843
TIL 597..650 CDD:280072
VWD 717..875 CDD:214566 23/128 (18%)
C8 913..989 CDD:214843
TIL 992..1046 CDD:280072
VWD 1102..1265 CDD:295339
C8 1349..1420 CDD:285899
TIL 1424..1477 CDD:280072
VWC 1479..1532 CDD:302663
VWD 1539..1690 CDD:278521
C8 1732..1803 CDD:214843
ZP 1850..2102 CDD:214579
Zona_pellucida 1982..2102 CDD:278526
FXa_inhibition 2132..2166 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.