DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn and VIT

DIOPT Version :9

Sequence 1:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster
Sequence 2:NP_444506.2 Gene:VIT / 5212 HGNCID:12697 Length:693 Species:Homo sapiens


Alignment Length:260 Identity:59/260 - (22%)
Similarity:99/260 - (38%) Gaps:72/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 VADVAPPEAAADLIIEPVEPPAPI--PDLLEQTTS-VPAVEAAESTSS----PIPETSLPPPN-E 581
            |..::.|......|:...:|...:  |..|..::| .||.:|.|:|.:    |||.|:..|.. .
Human   121 VQSLSLPRWRESFIVLESKPKKGVTYPSALTYSSSKSPAAQAGETTKAYQRPPIPGTTAQPVTLM 185

  Fly   582 AVASPEVAVAPITAPEPIPEPEPSLATPTEPIPVEAPVVIQEAVDAVEVPVTETSTSIPETTVEY 646
            .:.:..||||   .|..:|.|.||.|:.|.   :..|..:......:::..|.|.||    :...
Human   186 QLLAVTVAVA---TPTTLPRPSPSAASTTS---IPRPQSVGHRSQEMDLWSTATYTS----SQNR 240

  Fly   647 PVAEKVLDPAITEAPVTTQEPDVANINDGAPATEITTPAVEIVTAAAEVSDTAIPLIDPPVPQEI 711
            |.|    ||.|..     |:|..|                               ....||..::
Human   241 PRA----DPGIQR-----QDPSGA-------------------------------AFQKPVGADV 265

  Fly   712 AVAEIPETETKPAEVIVEQSTIPIEAPVPEVSKYA-EPVISEAPAAEVPIT---AGDNPDNTSVG 772
            ::.|:  ...||..|::::..:|.|    |:|..: |||....|..::.::   .|    :||:|
Human   266 SLGEM--DSWKPGSVLLDEGLVPKE----ELSTQSLEPVSLGDPNCKIDLSFLIDG----STSIG 320

  Fly   773  772
            Human   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CpnNP_731674.1 rne <9..167 CDD:236766
rne <109..300 CDD:236766
rne <228..409 CDD:236766
rne <331..594 CDD:236766 21/76 (28%)
rne <501..763 CDD:236766 55/249 (22%)
VITNP_444506.2 LCCL 44..133 CDD:281766 2/11 (18%)
vWFA 308..471 CDD:294047 4/17 (24%)
vWA_collagen 509..669 CDD:238749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.