DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn and CRIM1

DIOPT Version :9

Sequence 1:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster
Sequence 2:XP_011531200.1 Gene:CRIM1 / 51232 HGNCID:2359 Length:1077 Species:Homo sapiens


Alignment Length:376 Identity:76/376 - (20%)
Similarity:112/376 - (29%) Gaps:123/376 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 PVIAAPSDAPAE-APSAAAPIVSTPP--TTASVPETTAPPAAVPTEPIDVSVLSEAA-------I 509
            |....|:..|.: .||.|...|...|  :|.|:.........|..|..::...::..       .
Human   687 PACGNPTIHPGQCCPSCADDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQCTCHSGRVLC 751

  Fly   510 ETPVAPPVEVTTEVAVADVAPPEAAADLIIEPVEPPAPIPDLLEQTTSVP---------AVEAAE 565
            ||.|.||:.........|...|:...    :|..|.      |.:..|||         ...|||
Human   752 ETEVCPPLLCQNPSRTQDSCCPQCTD----QPFRPS------LSRNNSVPNYCKNDEGDIFLAAE 806

  Fly   566 STSSPIPETSLPPPNEAVASPEVAVAPITAPEPIPEPEPSLATPTEPIPVEAPVVIQEAVDAVEV 630
            |.                 .|:|..:.|                              .:|:|  
Human   807 SW-----------------KPDVCTSCI------------------------------CIDSV-- 822

  Fly   631 PVTETSTSIPETTVEYPVAEK-VLDPAITEAPVTTQEPDVANINDGAPATE--------ITTPAV 686
             ::..|.|.|..:.|.||..| ...|...|.  |..:..|.:.:..|.|.|        .....:
Human   823 -ISCFSESCPSVSCERPVLRKGQCCPYCIED--TIPKKVVCHFSGKAYADEERWDLDSCTHCYCL 884

  Fly   687 EIVTAAAEVSDTAIPLIDP--------PVPQEIAVAEIPETETKPAEVIVEQSTIPIEAPVPEVS 743
            :..|..:.||...:|.::|        |:..|:.|   ||....|.|....:..:.:|.|:    
Human   885 QGQTLCSTVSCPPLPCVEPINVEGSCCPMCPEMYV---PEPTNIPIEKTNHRGEVDLEVPL---- 942

  Fly   744 KYAEPVISEAPAAEVPITAG----DNPDN----------TSVGISEVVPTI 780
               .|..||.....:|...|    |..||          .|:. |.|||.|
Human   943 ---WPTPSENDIVHLPRDMGHLQVDYRDNRLHPSEDSSLDSIA-SVVVPII 989

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CpnNP_731674.1 rne <9..167 CDD:236766
rne <109..300 CDD:236766
rne <228..409 CDD:236766
rne <331..594 CDD:236766 31/157 (20%)
rne <501..763 CDD:236766 54/294 (18%)
CRIM1XP_011531200.1 IGFBP 39..90 CDD:278641
VWC 377..431 CDD:214564
VWC 444..497 CDD:214564
Antistasin 608..633 CDD:280912
VWC 653..703 CDD:302663 4/15 (27%)
VWC 724..775 CDD:302663 9/50 (18%)
VWC 799..849 CDD:214564 17/99 (17%)
VWC 860..914 CDD:302663 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.