DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn and cv-2

DIOPT Version :9

Sequence 1:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster
Sequence 2:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster


Alignment Length:136 Identity:34/136 - (25%)
Similarity:43/136 - (31%) Gaps:52/136 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 PETP-----ALAPVVAE------SQVAANTVVATPPTPAPEPET-----IAPPVVAETPEV-ASV 344
            ||.|     .:|.||.|      ||...|.:  .||.|.....|     |....|||..|| ||:
  Fly   139 PEDPCKTYKCVATVVTETIQKCYSQCDNNQL--QPPRPGECCPTCQGCKINGQTVAEGHEVDASI 201

  Fly   345 --------------AVAETTPPVVPPVAAESIPAPVVATTPVPATLAVTDPDVTASAVPELPPVI 395
                          ..::.|.||:                |.|.:..:..||   ...|..|...
  Fly   202 DDRCLVCQCRGTQLTCSKKTCPVL----------------PCPMSKQIKRPD---ECCPRCPQNH 247

  Fly   396 APSPVP 401
            :..|||
  Fly   248 SFLPVP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CpnNP_731674.1 rne <9..167 CDD:236766
rne <109..300 CDD:236766 2/2 (100%)
rne <228..409 CDD:236766 34/136 (25%)
rne <331..594 CDD:236766 19/86 (22%)
rne <501..763 CDD:236766
cv-2NP_524809.2 VWC 184..243 CDD:214564 16/77 (21%)
VWC 256..310 CDD:278520
VWC 319..376 CDD:214564
VWD 371..536 CDD:214566
C8 580..646 CDD:285899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.