DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn and crim1

DIOPT Version :9

Sequence 1:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster
Sequence 2:NP_997986.1 Gene:crim1 / 404210 ZFINID:ZDB-GENE-040312-2 Length:1027 Species:Danio rerio


Alignment Length:280 Identity:55/280 - (19%)
Similarity:87/280 - (31%) Gaps:105/280 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 PATETPVVAPAAASPHVSVAPAVETAVVAPVSASTEPPVAAATLTTAP--------ETPAL---- 302
            |..:.|.:.|....|           .....|:|.:|.::.|::..||        ||..:    
Zfish   641 PPCDNPTIRPGHCCP-----------TCPEESSSHKPELSEASVCLAPGGEYFVEGETWNIDSCT 694

  Fly   303 ------APVVAESQVAANTVVATPPTPAPEPETIAPPVVAETPEVASVAVAETTPPVVPPVAAES 361
                  ..|:.|::|                   .||::..:|    :...::..|..|      
Zfish   695 QCTCHSGRVLCETEV-------------------CPPLLCHSP----IRTQDSCCPHCP------ 730

  Fly   362 IPAPVVATTP----VPATLAVTDPDVTASAVPELPPV----IAPSPVPSAVAET--PVDLAPPVL 416
             ..||...||    :|:.....|.|:..:|....|.|    :......|..:|:  ||:.|.|||
Zfish   731 -DDPVTPQTPSNDSMPSYCRNEDGDIFLAAESWKPNVCSSCVCLDGAISCFSESCPPVNCARPVL 794

  Fly   417 P-----PVAAEPVPAVVA---------EE--------------------TPETPA-PASAPVTIA 446
            .     |...:..|..|.         ||                    |...|| |...|:|:.
Zfish   795 RKGQCCPYCLDATPRAVCHFNGKTYMDEERWDIDSCTHCYCLQGQTLCSTVSCPALPCHQPLTVE 859

  Fly   447 ALDIPEVAPVIAAPSDAPAE 466
            ....| :.|...||::.|.|
Zfish   860 GSCCP-MCPESYAPTNVPIE 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CpnNP_731674.1 rne <9..167 CDD:236766
rne <109..300 CDD:236766 11/57 (19%)
rne <228..409 CDD:236766 32/186 (17%)
rne <331..594 CDD:236766 40/181 (22%)
rne <501..763 CDD:236766
crim1NP_997986.1 IGFBP 33..84 CDD:278641
Cell attachment site. /evidence=ECO:0000255 308..310
VWC 330..384 CDD:214564
VWC 397..450 CDD:302663
Antistasin 561..586 CDD:280912
VWC 607..657 CDD:302663 4/26 (15%)
VWC 678..729 CDD:302663 9/73 (12%)
VWC 751..803 CDD:302663 14/51 (27%)
VWC 812..866 CDD:302663 9/54 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 877..897 1/2 (50%)
Cell attachment site. /evidence=ECO:0000255 883..885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.