DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn and Rcd2

DIOPT Version :9

Sequence 1:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster
Sequence 2:NP_649244.3 Gene:Rcd2 / 40283 FlyBaseID:FBgn0037012 Length:452 Species:Drosophila melanogaster


Alignment Length:505 Identity:98/505 - (19%)
Similarity:151/505 - (29%) Gaps:197/505 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 SAAAPIVSTPPTTASVPETTAPPAAVPTEPIDVSVLSEA----AIETPVAPPVEVTTE------- 522
            |.|.||:...    |:.|:.|.|......||...|:.|.    .:.....|..|...|       
  Fly    16 SCAMPIIDPD----SIDESLACPPCENDFPICYKVIVEVERGNGLPGSCCPRYECLDEEPVCDGS 76

  Fly   523 --------VAVADVAPPEAAADLIIEPVEPPAPI------------------------------- 548
                    ..|.|...|.|.....|.|:|.|.||                               
  Fly    77 KRRFYKNKCTVCDPCEPLAIQCKEICPMEEPEPICLSDNNEYHRNGDIWMENNGCTTCMCEGGYV 141

  Fly   549 ---------------------------PDLL--------------EQTTSVPAVEAAES------ 566
                                       ||.|              ..|||.|.:..:||      
  Fly   142 TRNAVQCNHYYRCNNPVEVKGQCCPVCPDELGVSNSIYDDGNHKYRNTTSAPILGESESSSSGWS 206

  Fly   567 ------TSSPIPETSLPPPNEAVASPEVAVAPITAPEPIPEPEPSLATPTEPIPVEAPVVIQEAV 625
                  ||..:|:|| ..||.:..|.|                  |||||               
  Fly   207 STVPTDTSDSVPDTS-GSPNSSSTSSE------------------LATPT--------------- 237

  Fly   626 DAVEVPVTETSTSIPETTVEYPVAEKVLDPAITEAP--VTTQEPDVANINDGAPATEITTPAVEI 688
                 |.|...:|..|.|......|::.:.|.:|:|  .|..|....:.:|.|..| .|.|....
  Fly   238 -----PNTSELSSSTERTSTDSSYEQLGEFATSESPDLRTDSEEQETSSSDSAMET-TTNPTTFE 296

  Fly   689 VTAAAEVSDTAIPLIDPPVPQEIAVAEI--------PETETKPAEVIVEQSTIPIEAPVPEVSKY 745
            .||.:.||.|::.|   |...:..:.::        |:...:|..::|..:..        :|..
  Fly   297 ATATSTVSSTSMEL---PTATDDGITKMDFNPDGRTPKATDEPTVILVNATNF--------LSVV 350

  Fly   746 AEPVISEAPAAEVPITAGDNPDNTSVGISEVVPTIAEKAVEEVPTSEIPE---QSSSPSDSVPVA 807
            .:..|:..||...|.:.....|..|:.|.::          ..|.:|:|:   |:..|.:.|.:.
  Fly   351 TDNPITNQPAVVAPESTSQIKDLNSMEIQQI----------RYPYAEVPQERIQTDWPLECVVIM 405

  Fly   808 KITPLLRDLQTTDVSLLAI-----------AATLDAIGEKLKDQKARNQQ 846
            ....|:     ..:||.||           |..|:.:.:..:.:||:.:|
  Fly   406 GFVILI-----VFISLYAIVKRYSKNKKYHAIPLNPVRKLNETEKAKTEQ 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CpnNP_731674.1 rne <9..167 CDD:236766
rne <109..300 CDD:236766
rne <228..409 CDD:236766
rne <331..594 CDD:236766 43/227 (19%)
rne <501..763 CDD:236766 69/374 (18%)
Rcd2NP_649244.3 VWC 114..168 CDD:214564 0/53 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.