| Sequence 1: | NP_731674.1 | Gene: | Cpn / 41474 | FlyBaseID: | FBgn0261714 | Length: | 864 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_008762649.1 | Gene: | Vit / 313831 | RGDID: | 1564128 | Length: | 651 | Species: | Rattus norvegicus |
| Alignment Length: | 324 | Identity: | 63/324 - (19%) |
|---|---|---|---|
| Similarity: | 93/324 - (28%) | Gaps: | 133/324 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 566 STSSPIPETSLPPPNEA-VASPEVAVAPITAPEPIPEPEPSLATPTEPIPVEAPVVIQEAVDAVE 629
Fly 630 VPVTETSTSIPETTVEYPVAEKVLDPAITEAPVTTQEPDVANINDGAPATEITTPAVEIVTAAAE 694
Fly 695 VSDTAIPLIDPPVPQEIAVAEIPETET-KPAEVIVEQSTIPIEAPVPEVS-KYAEPVISEAPAAE 757
Fly 758 VPIT-----------------------------------------AGDNPD-------------- 767
Fly 768 NTSV-------GISEV---------------------VPTIAEKAVEEVPTSEIPEQSSSPSDS 803 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cpn | NP_731674.1 | rne | <9..167 | CDD:236766 | |
| rne | <109..300 | CDD:236766 | |||
| rne | <228..409 | CDD:236766 | |||
| rne | <331..594 | CDD:236766 | 8/28 (29%) | ||
| rne | <501..763 | CDD:236766 | 46/240 (19%) | ||
| Vit | XP_008762649.1 | LCCL | 45..134 | CDD:281766 | 6/16 (38%) |
| vWA_collagen | 265..409 | CDD:238749 | 17/129 (13%) | ||
| vWA_collagen | 467..627 | CDD:238749 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1216 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||