DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpn and C16E9.1

DIOPT Version :9

Sequence 1:NP_731674.1 Gene:Cpn / 41474 FlyBaseID:FBgn0261714 Length:864 Species:Drosophila melanogaster
Sequence 2:NP_509176.2 Gene:C16E9.1 / 182693 WormBaseID:WBGene00015865 Length:565 Species:Caenorhabditis elegans


Alignment Length:298 Identity:60/298 - (20%)
Similarity:87/298 - (29%) Gaps:115/298 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 PVAPPVEVTTEVAVADVAPPEAAADLIIEPVEPPAPIPDLLEQTTSVPAVEAAESTSSPIPETSL 576
            |..||          ...||       :.|.:||...||....||..||                
 Worm    29 PYNPP----------GYMPP-------MPPTDPPGYDPDSTFDTTPTPA---------------- 60

  Fly   577 PPPNEAVASPEVAVAPITAPEPIPEPEPSLATPTEPIPVEA--------PVVIQEAVDAVEVPVT 633
             ||:..:.:|           |:|:       .|:.||.|:        .||:...:|:   .|.
 Worm    61 -PPSNGLRAP-----------PMPK-------WTQEIPKESSGQQLKIEDVVVGNNIDS---HVE 103

  Fly   634 ETSTSIPETTVEYPVAEKVLDPAITEAPVTTQEPDVANINDGAPATEITTPAV-EIVTAAAEVSD 697
            |.:.|               ....||...:..:.......|.:.|...:.|.: :.:.:.|||..
 Worm   104 EVNGS---------------GSGDTEGSGSGDKSGTEESFDASGAQGDSLPDIMKAMDSEAEVLG 153

  Fly   698 TAIP-----LIDPPVPQEIAVAEIPETETKPAEVIVEQSTIPIEAPV------PEVSKYAEPVIS 751
            ...|     :||               .|.....|.||....||..|      |.|......|.|
 Worm   154 VNCPSDIIFVID---------------ATSSVRGIFEQYITYIEKVVEGLDVQPTVDHVGAIVYS 203

  Fly   752 EAPAAEVPITAGDNPDNTSVGISEVVPTIAEKAVEEVP 789
            ........|..|::.|..|:          .|||:|:|
 Worm   204 SEKKQRTKIKLGEHKDRGSL----------VKAVDELP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CpnNP_731674.1 rne <9..167 CDD:236766
rne <109..300 CDD:236766
rne <228..409 CDD:236766
rne <331..594 CDD:236766 17/81 (21%)
rne <501..763 CDD:236766 52/270 (19%)
C16E9.1NP_509176.2 VWA_integrin_invertebrates 158..315 CDD:238753 22/99 (22%)
VWA 391..555 CDD:278519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.