| Sequence 1: | NP_731674.1 | Gene: | Cpn / 41474 | FlyBaseID: | FBgn0261714 | Length: | 864 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001158129.3 | Gene: | Fcgbp / 100303643 | RGDID: | 2313189 | Length: | 2583 | Species: | Rattus norvegicus |
| Alignment Length: | 300 | Identity: | 57/300 - (19%) |
|---|---|---|---|
| Similarity: | 83/300 - (27%) | Gaps: | 108/300 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 570 PIPETSLPPPNEAVASPEVAVAPITAPEPIPEPEPSLATPTEPI--------------------- 613
Fly 614 -----------------------PVEAPVVIQEAVDAVEVPVTETSTSIP---ETTVE------- 645
Fly 646 ---------YPVAE---------KVLDPAITEAP-------------VTTQEP------DVANIN 673
Fly 674 DGAPATE-------ITTPAVEIVTAAAEVSDT------AIPLIDPPVP--QEIAVAEIPETETKP 723
Fly 724 AEVIVE-QSTIPIEAPVPEVSKYAEPVISEAPAAEVPITA 762 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cpn | NP_731674.1 | rne | <9..167 | CDD:236766 | |
| rne | <109..300 | CDD:236766 | |||
| rne | <228..409 | CDD:236766 | |||
| rne | <331..594 | CDD:236766 | 6/23 (26%) | ||
| rne | <501..763 | CDD:236766 | 56/299 (19%) | ||
| Fcgbp | NP_001158129.3 | VWD | 56..210 | CDD:395046 | |
| C8 | 251..326 | CDD:214843 | |||
| TIL | 329..383 | CDD:396409 | |||
| VWD | 448..603 | CDD:395046 | |||
| C8 | 642..717 | CDD:214843 | |||
| TIL | 720..773 | CDD:396409 | |||
| VWC | 775..829 | CDD:327433 | |||
| VWD | 836..991 | CDD:395046 | |||
| C8 | 1034..1109 | CDD:214843 | |||
| TIL | 1112..1165 | CDD:396409 | |||
| VWC | 1167..1219 | CDD:327433 | |||
| VWD | 1253..1412 | CDD:395046 | |||
| C8 | 1451..1526 | CDD:214843 | |||
| TIL | 1530..1584 | CDD:410995 | |||
| VWD | 1652..1808 | CDD:395046 | |||
| C8 | 1840..1914 | CDD:214843 | 12/74 (16%) | ||
| TIL | 1917..1970 | CDD:396409 | 11/52 (21%) | ||
| VWD | 2024..2180 | CDD:214566 | 20/101 (20%) | ||
| C8 | 2222..2296 | CDD:214843 | |||
| TIL | 2299..2352 | CDD:396409 | |||
| VWC | 2357..2407 | CDD:327433 | |||
| VWD | 2406..2560 | CDD:413350 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1216 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||