DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and PAPLN

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:179 Identity:38/179 - (21%)
Similarity:60/179 - (33%) Gaps:47/179 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FGDAPSI-PIGVAPATTTTIDPATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAY 208
            ||.|.:. |:|..|:       :...|....|....:|               :.:.:..|....
Human  1020 FGQAGAAGPLGAIPS-------SHPQPANRLRLDQNQP---------------RVVDASPGQRIR 1062

  Fly   209 LPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSP----NPERWSLQIKYVQLKDEG 269
            :.|..:......|.|  .|||                |.|.||    .|: .||.|..|.::|.|
Human  1063 MTCRAEGFPPPAIEW--QRDG----------------QPVSSPRHQLQPD-GSLVISRVAVEDGG 1108

  Fly   270 TYEC-QVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIIS 317
            .|.| ..:.:.:....|.||::...|......|..|..|...:|.|:::
Human  1109 FYTCVAFNGQDRDQRWVQLRVLGELTISGLPPTVTVPEGDTARLLCVVA 1157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 22/96 (23%)
V-set 204..290 CDD:284989 23/90 (26%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767
Ig 914..>978 CDD:325142
I-set 1049..1119 CDD:254352 21/103 (20%)
IG 1139..1219 CDD:214652 5/19 (26%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.