DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and KIRREL2

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:465 Identity:88/465 - (18%)
Similarity:137/465 - (29%) Gaps:143/465 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPTIDDYQTIISQAGTHAYLPC------NVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSV 248
            |..:...:.::...|..|.|||      .:.|..|..::....||                    
Human    24 PHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRD-------------------- 68

  Fly   249 FSPNPERW-----------SLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEP--KTELIGES 300
             .|...|:           .|.|:.|:|:||.:||||.:.....|....|.::.|  ..:::|..
Human    69 -LPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGP 132

  Fly   301 TRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTT-- 363
            :..:.||....|.|.......|...:.||  :..:.|......:|.::. ..|..|.:|.|.|  
Human   133 SVSLVAGVPANLTCRSRGDARPTPELLWF--RDGVLLDGATFHQTLLKE-GTPGSVESTLTLTPF 194

  Fly   364 -------------TTTTTTASTTTTTTS-------TTPATPSTTATGSTE----GATSSETLNGL 404
                         :....|...|..|.|       |..|:|.|...|...    .||:...:.|.
Human   195 SHDDGATFVCRARSQALPTGRDTAITLSLQYPPEVTLSASPHTVQEGEKVIFLCQATAQPPVTGY 259

  Fly   405 --------VTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEA------TSSTSGTS 455
                    |...|...|:.::  |.|.|.......|:....:|...|.::.      .:.....|
Human   260 RWAKGGSPVLGARGPRLEVVA--DASFLTEPVSCEVSNAVGSANRSTALDVLFGPILQAKPEPVS 322

  Fly   456 TGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAATTAATTTTTMLPSSSFI 520
            ...|..||.|.|:.......:|                |.....|:...:.||            
Human   323 VDVGEDASFSCAWRGNPLPRVT----------------WTRRGGAQVLGSGAT------------ 359

  Fly   521 KQITTASLIIPAVVKLDSGNYTCSPS-----------------NSAPRTIVLHVLNGEYSASAIK 568
                   |.:|:|...|:|:|.|...                 |:.|....||      ||.|..
Human   360 -------LRLPSVGPEDAGDYVCRAEAGLSGLRGGAAEARLTVNAPPVVTALH------SAPAFL 411

  Fly   569 SGSVSWSALI 578
            .|......|:
Human   412 RGPARLQCLV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 23/108 (21%)
V-set 204..290 CDD:284989 23/102 (23%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 23/109 (21%)
IGc2 38..106 CDD:197706 21/88 (24%)
I-set 126..224 CDD:254352 19/100 (19%)
Ig2_KIRREL3-like 141..223 CDD:143236 15/84 (18%)
Cell attachment site. /evidence=ECO:0000255 149..151 0/1 (0%)
Ig 231..306 CDD:299845 16/76 (21%)
IG_like 234..308 CDD:214653 15/75 (20%)
Ig 312..395 CDD:299845 18/117 (15%)
I-set 317..395 CDD:254352 18/112 (16%)
Ig 397..501 CDD:299845 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.