DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and NECTIN4

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_011508323.1 Gene:NECTIN4 / 81607 HGNCID:19688 Length:511 Species:Homo sapiens


Alignment Length:377 Identity:73/377 - (19%)
Similarity:123/377 - (32%) Gaps:94/377 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 DYQTIISQAGTHAYLPC--------NVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSP 251
            |..|::  .|..|.|||        .|.|     ::|.|:..|.   ..|...:...::....||
Human    38 DVVTVV--LGQDAKLPCFYRGDSGEQVGQ-----VAWARVDAGE---GAQELALLHSKYGLHVSP 92

  Fly   252 -------------NPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLR---IVEPKTELIGES 300
                         ||...|:.::.....|||.|||:|||.|..|....||   :|.|...|....
Human    93 AYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGP 157

  Fly   301 TRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTT 365
            ......|..:...|....:..|.:                 .|.||::            .||::
Human   158 ALEEGQGLTLAASCTAEGSPAPSV-----------------TWDTEVK------------GTTSS 193

  Fly   366 TTTTASTTTTTTSTTPATPSTTATG-------STEGATSSETLNGLVTITRSYILDA----ISQN 419
            .:...|.:...||.....||.:..|       |..|....:.:..::.:  |::.:|    :...
Human   194 RSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHILHV--SFLAEASVRGLEDQ 256

  Fly   420 DVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDS 484
            ::..:|        .|.:..:.|:|.:...|.:.|.....|   .|.....|...|.....|..|
Human   257 NLWHIG--------REGAMLKCLSEGQPPPSYNWTRLDGPL---PSGVRVDGDTLGFPPLTTEHS 310

  Fly   485 AATAATTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQI--TTASLIIPAVV 534
            .......|...::.|::     .|......|.....||:  .:||:::..|:
Human   311 GIYVCHVSNEFSSRDSQ-----VTVDVLADPQEDSGKQVDLVSASVVVVGVI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 30/115 (26%)
V-set 204..290 CDD:284989 29/109 (27%)
NECTIN4XP_011508323.1 IG_like 37..145 CDD:214653 31/116 (27%)
Ig1_Nectin-4_like 46..146 CDD:143296 28/107 (26%)
Ig2_Nectin-3-4_like 149..242 CDD:143328 18/121 (15%)
IG_like 259..332 CDD:214653 15/88 (17%)
IGc2 268..320 CDD:197706 11/54 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.