DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and nectin4b

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_001334985.6 Gene:nectin4b / 794920 ZFINID:ZDB-GENE-070912-114 Length:570 Species:Danio rerio


Alignment Length:350 Identity:68/350 - (19%)
Similarity:108/350 - (30%) Gaps:106/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 IDDYQTIISQAGTHAYLPC---NVKQLVKKPISWLRM----RDGHILTVDQT-------TFIADQ 243
            :|...::.|.:|:.|.|.|   ..:.:....::|.|.    :...|:|...|       .|....
Zfish    23 MDSPMSLRSFSGSEARLKCVFVAPRDVTVVQVTWSRHTPAGKTQQIITGHYTEGPKVSPEFADGF 87

  Fly   244 RFQSVFSPNPERWS-LQIKYVQLKDEGTYECQVSTEPKA---------------SAIVHLRIVEP 292
            ||:   ||:|...| |.|:.....|||.|.|.::|.|..               |::.|:.:.|.
Zfish    88 RFE---SPDPLTDSTLLIENTVRADEGVYTCSIATFPSGNFQRRISLSVWMYPISSVEHVVLKEG 149

  Fly   293 KTELIGESTRHVKAGSQVKLRCIISQALEPPLFINW---FYNQKQIYLHNRRG------------ 342
            ::..|..|.|.|               ..||..::|   ...|.|    ||.|            
Zfish   150 QSYGIAASCRAV---------------AHPPARLSWDTDVSGQSQ----NRSGDGGVVTTQFSLY 195

  Fly   343 --------------WRTEIER---------IDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATP 384
                          |....|.         :..|.:.....:.:....::.|.........| .|
Zfish   196 PSRSMNGQKLDCLVWHPVYEEPHRLANKLVVQFPPDAEAVGSGSWQIGSSGSEIRCLVKGNP-LP 259

  Fly   385 STTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETST-----AQLLTE 444
            ...:...::|...|..   ||...|......:.|.|       .||.|....:|     |:...:
Zfish   260 QNVSWSRSDGVLPSGV---LVQKDRLVFSRPLQQTD-------EGVYVCRTHNTLGVAKAEFTLQ 314

  Fly   445 VEATSSTSGTSTGAGLLASTSAAYA 469
            ::|..|....|:...||....||.|
Zfish   315 IDAVRSEFSISSSHTLLIVIGAASA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 28/121 (23%)
V-set 204..290 CDD:284989 27/115 (23%)
nectin4bXP_001334985.6 Ig 36..134 CDD:325142 24/100 (24%)
Ig 146..226 CDD:325142 15/98 (15%)
Ig 248..315 CDD:325142 14/77 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.