DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and nectin3a

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_017206634.2 Gene:nectin3a / 793240 ZFINID:ZDB-GENE-130530-670 Length:550 Species:Danio rerio


Alignment Length:427 Identity:91/427 - (21%)
Similarity:146/427 - (34%) Gaps:86/427 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IISQAGTHAYLPCNVK---QLVKKPISWLRMRDGHILTVD-----QTTFIADQRFQSV--FSPNP 253
            :.|..|.:..|.|.::   .|.....||.|.....|:|:.     ..|.:||:..:.|  ..|:.
Zfish    43 VTSVLGKNVTLSCRMEMSSNLSLTQSSWERHLPSGIITLAVFNPVYGTSVADEYSRRVHFLKPSV 107

  Fly   254 ERWSLQIKYVQLKDEGTYECQVST----EPKASAIVHLRIVEPKTELI-GESTRHVKAGSQVKLR 313
            ...|:.::.|...|.|.|.|::.|    ..:||..|.: :||||..:. |..:.....|..:...
Zfish   108 HDVSIVLQGVGFADIGMYTCKMVTFELGNMQASTNVDV-MVEPKVYVSPGSLSLTADDGETLVAT 171

  Fly   314 CIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTS 378
            |...:. .|...:.|                    ..|||.:      |...|.:....||||..
Zfish   172 CTAERG-RPAAEVFW--------------------ESDLPGQ------TAVVTQSEPEGTTTTLV 209

  Fly   379 TTPATPSTTATGSTEGATSSETLNGLV---TITRS----YILDAISQNDVSELGAA----AG--- 429
            .....|:..:.|        .:|:.:|   .::|.    |.|:.....||..:|..    .|   
Zfish   210 HYVLAPTRASHG--------RSLSCVVRHPALSRDFRIPYRLNVFFVPDVMVIGGKNVWYVGQKD 266

  Fly   430 -----VAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAA 489
                 .|.|...:...|.|.::|. ..:|.:...|.|..|....|..  :|.......:......
Zfish   267 VQLDCKANANPPALFYLWTRLDAL-MPAGVNMHNGSLVFTRPLEATD--SGQYRCEVQNDVGQNF 328

  Fly   490 TTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTIV 554
            ....:| .:|....|.|.|||||.   |..:...|:.::..|    ::...:..||:.|:||...
Zfish   329 HDVPFL-VLDPPPTTAAPTTTTTF---SKSLHPDTSLTITAP----INQRAHFSSPTRSSPRDAD 385

  Fly   555 LHVLNGEYSASAIKSGSVSWSALIGCHGYLHWRNVST 591
            |..|.|     .|..|.:....|:...|..:.|...|
Zfish   386 LSTLVG-----GIVGGILILVLLLALAGAFYMRRRRT 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 25/103 (24%)
V-set 204..290 CDD:284989 24/99 (24%)
nectin3aXP_017206634.2 Ig 49..146 CDD:325142 23/97 (24%)
Ig 149..245 CDD:325142 23/130 (18%)
Ig 264..325 CDD:325142 11/63 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.