DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and BTN1A1

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001723.2 Gene:BTN1A1 / 696 HGNCID:1135 Length:526 Species:Homo sapiens


Alignment Length:288 Identity:59/288 - (20%)
Similarity:92/288 - (31%) Gaps:111/288 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPTIDDYQTIISQAGTHAYLPCNVKQLVKK---PISWLRM---------RDGHILTVDQ------ 236
            ||     :.|::..|..|.|||.:......   .:.|.|.         |||.....:|      
Human    34 PP-----EPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRG 93

  Fly   237 -TTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPK-ASAIVHLRIV----EPKTE 295
             .|.:.|...:.       |.:|:|:.|::.|:|.|.|....:.. ..|:|||::.    :|...
Human    94 RATLVQDGIAKG-------RVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHIS 151

  Fly   296 LIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTS 360
            :      .|:...::.|.|         ..:.| |.:.|:.      ||                
Human   152 M------QVQENGEICLEC---------TSVGW-YPEPQVQ------WR---------------- 178

  Fly   361 TTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLN----GLVTITRSYILDAISQNDV 421
                            ||.....|||           ||:.|    ||.|:..|.|:...|..:|
Human   179 ----------------TSKGEKFPST-----------SESRNPDEEGLFTVAASVIIRDTSAKNV 216

  Fly   422 S------ELGAAAGVAVATETSTAQLLT 443
            |      .||....|.::...|:...||
Human   217 SCYIQNLLLGQEKKVEISIPASSLPRLT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/111 (23%)
V-set 204..290 CDD:284989 25/105 (24%)
BTN1A1NP_001723.2 IG_like 35..141 CDD:214653 27/117 (23%)
Ig_MOG_like 43..142 CDD:143190 25/105 (24%)
Ig 162..223 CDD:299845 23/119 (19%)
SPRY_PRY_BTN1_2 302..473 CDD:293991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.