DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Btnl4

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_109671.1 Gene:Btnl4 / 632126 MGIID:1932036 Length:586 Species:Mus musculus


Alignment Length:357 Identity:70/357 - (19%)
Similarity:110/357 - (30%) Gaps:97/357 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IISQAGTHAYLPC------NVKQLVKKPISWLRMR---------------DGHILTVDQTTFIAD 242
            |::..|..|.|||      ||:.:  :.:.|.|.|               :|.:....|.|.:..
Mouse    40 IVAAPGGEAILPCSVFPAMNVENM--EELRWFRSRFSEAVLFYRDQEEQKEGQMPGYSQRTLLVK 102

  Fly   243 QRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTR-HVKA 306
            .:|....:      :::|..||..|.|.|.|..    :........|:|.|...:|.... |:|.
Mouse   103 DQFHQGTA------AVRILNVQASDSGIYICHF----QQGVFYDEAILELKVAAMGSVPEVHIKG 157

  Fly   307 GSQ--VKLRCIISQALEPPLFINWFYNQKQIYLHNRRG-----WRTEIERIDLPAEVPTTSTTTT 364
            ...  |.:.|:.|         .| |.:.|::..:.||     :.:|....|...   ..||.|.
Mouse   158 PEDGGVCVVCMTS---------GW-YPEPQVHWKDSRGENLTAFSSETHTKDAEG---LFSTETL 209

  Fly   365 TTTTTASTTTTTTS-----------------------TTPATPSTTATGSTEGATSSETLNGLVT 406
            .....:|....|.|                       .:|..|:...|         .|:.||:.
Mouse   210 LVVRDSSVRNVTCSIFNPILGQEKATAMFIPEPFFPQASPWKPAFLVT---------LTMMGLLV 265

  Fly   407 ITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAG 471
            :..||:|         ....:|.:.|..||...|...:....:......|...|:.......||.
Mouse   266 LGTSYLL---------RREHSARLKVQQETVNFQREKDESLKTRDDALRTAGALMVERDRRKAAY 321

  Fly   472 AAAGITTAATGDSAATAATTSAWLTTMDAEAA 503
            .||........|  .......||..|:|..:|
Mouse   322 RAAWKKAQLYAD--WRKEHFEAWTFTLDPASA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 22/110 (20%)
V-set 204..290 CDD:284989 21/106 (20%)
Btnl4NP_109671.1 Ig 45..145 CDD:386229 24/111 (22%)
Ig <167..233 CDD:386229 15/78 (19%)
SPRY_PRY_C-I_1 344..497 CDD:293968 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.