DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Nectin3

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_067470.1 Gene:Nectin3 / 58998 MGIID:1930171 Length:549 Species:Mus musculus


Alignment Length:361 Identity:73/361 - (20%)
Similarity:119/361 - (32%) Gaps:109/361 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NVQEQHSYRITQDN-ATSAASIAPNGTAFGD-------APSIPIGVAPATTTT------------ 162
            :||..:..|:...| :.:.|:|..:...|.|       |.:.|:|.|.::||.            
Mouse   112 SVQGDYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIK 176

  Fly   163 -----IDPATTTPTTTTRRTTRRPVA-------------TTTLKPPPT---IDDYQTIISQAGTH 206
                 ||....|........|.:|||             :||..|..|   :..|:...::....
Mouse   177 GPDSLIDGGNETVAAVCVAATGKPVAQIDWEGDLGEMESSTTSFPNETATIVSQYKLFPTRFARG 241

  Fly   207 AYLPCNVKQ-LVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPE--------RWSLQIKY 262
            ..:.|.||. .::|.|.:              :||.|.::.      ||        .|.:..|.
Mouse   242 RRITCVVKHPALEKDIRY--------------SFILDIQYA------PEVSVTGYDGNWFVGRKG 286

  Fly   263 VQLKDEGTYECQVSTEPKASAIVHLRI--VEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLF 325
            |.||      |.....|.....|..|:  ..|...|..::|.|                ...||.
Mouse   287 VNLK------CNADANPPPFKSVWSRLDGQWPDGLLASDNTLH----------------FVHPLT 329

  Fly   326 INWFYNQKQIY---LHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTT-----TTTTSTTPA 382
            :|:    ..:|   :.|..|.|:: :::...::.|||:|...|....:|..     .|.....|.
Mouse   330 VNY----SGVYVCKVSNSLGQRSD-QKVIYISDPPTTTTLQPTVQWHSSPADVQDIATEHKKLPF 389

  Fly   383 TPSTTAT--GSTEGATSSETLNGLVTITRSYILDAI 416
            ..||.||  ..|.|...:..:.|.:.:....||..:
Mouse   390 PLSTLATLKDDTIGTIIASVVGGALFLVLVSILAGV 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 18/100 (18%)
V-set 204..290 CDD:284989 19/96 (20%)
Nectin3NP_067470.1 IG_like 64..166 CDD:214653 14/53 (26%)
Ig1_Nectin-3_like 72..167 CDD:143295 14/54 (26%)
Ig 170..265 CDD:299845 19/108 (18%)
IG_like 287..348 CDD:214653 17/86 (20%)
Ig_3 <287..342 CDD:290638 15/80 (19%)
TM_EGFR-like 402..432 CDD:213052 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.