| Sequence 1: | NP_001287299.1 | Gene: | dpr15 / 41473 | FlyBaseID: | FBgn0037993 | Length: | 662 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
| Alignment Length: | 461 | Identity: | 81/461 - (17%) |
|---|---|---|---|
| Similarity: | 137/461 - (29%) | Gaps: | 174/461 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 170 PTTTTRRTTRRPVATTTLKPPPTIDD------YQTIISQAGTHAYLPCNVKQLVKKPISWLRMRD 228
Fly 229 GHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPK 293
Fly 294 TELIGESTRHVKA---------------------------GSQVKLR------------------ 313
Fly 314 ---------CIISQALEPPL-----------------------------------------FINW 328
Fly 329 FYNQ---------KQIYLHN--RRGWRTEIERI--------------------------DLPAEV 356
Fly 357 PTTSTTTTTTTTTAS-----------TTTTTTSTT----------PATPSTTATGSTEGATSSET 400
Fly 401 LNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTS 465
Fly 466 AAYAAG 471 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr15 | NP_001287299.1 | IG_like | 197..289 | CDD:214653 | 25/91 (27%) |
| V-set | 204..290 | CDD:284989 | 25/85 (29%) | ||
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 25/93 (27%) |
| Ig | 145..238 | CDD:416386 | 9/92 (10%) | ||
| Ig strand A | 145..149 | CDD:409353 | 0/3 (0%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 165..172 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 178..183 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 203..209 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 216..223 | CDD:409353 | 2/6 (33%) | ||
| Ig strand G | 230..238 | CDD:409353 | 0/7 (0%) | ||
| Ig | 242..333 | CDD:416386 | 9/90 (10%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 272..277 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 295..305 | CDD:409353 | 2/9 (22%) | ||
| Ig strand F | 314..322 | CDD:409353 | 0/7 (0%) | ||
| Ig strand G | 325..334 | CDD:409353 | 0/8 (0%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||