DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and CG34353

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:158 Identity:44/158 - (27%)
Similarity:62/158 - (39%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 TLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFS 250
            |...|..|...:|.....|....|||.|.......::|  .|...|||........|.|.:.|  
  Fly    82 TKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKVTPDPRVRLV-- 142

  Fly   251 PNPERWSLQIKYVQLKDEGTYECQVST-EPKASAIVHL--RIVEPKTELIGESTR-HVKAGSQVK 311
               ..::|||:.....|.|.|.||::| :|:  .|.|.  .:|.|:...|..... .||.||.|:
  Fly   143 ---NGFNLQIRDALPTDAGDYICQIATMDPR--EITHTVEILVPPRIHHISTGGHLQVKKGSSVR 202

  Fly   312 LRCIISQALEPPLFINWFYNQKQIYLHN 339
            :.|  |....|...:.|  ::|...|.|
  Fly   203 IEC--SATGNPMPNVTW--SRKNNILPN 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/94 (28%)
V-set 204..290 CDD:284989 25/88 (28%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 25/88 (28%)
Ig 103..177 CDD:143165 24/82 (29%)
IG_like 191..269 CDD:214653 12/40 (30%)
IGc2 198..258 CDD:197706 10/33 (30%)
I-set 273..360 CDD:254352
Ig 290..359 CDD:143165
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.