DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and cadm2b

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_005157530.1 Gene:cadm2b / 571698 ZFINID:ZDB-GENE-080506-3 Length:441 Species:Danio rerio


Alignment Length:169 Identity:45/169 - (26%)
Similarity:67/169 - (39%) Gaps:28/169 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 TRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTF--- 239
            |:..|..:..:.|.|    |.:....|:.|.:.|.|.......:.|..       ...||.|   
Zfish    24 TKNKVKGSQAQFPIT----QNVTVVEGSTANMTCRVDYNDNTSLQWSN-------PAQQTLFFGD 77

  Fly   240 ---IADQRFQSVFSPNPERW---SLQIKYVQLKDEGTYECQVSTEPKASAIVHLRI--VEPKTEL 296
               :.|.|.:.|.:    .|   ::.|..|.|.|||.|.|.:.|.|..::...|.:  |..|.|:
Zfish    78 KKALRDNRIELVRA----SWKELTISISDVALSDEGQYTCSLFTMPVKTSKAFLTVLGVPAKPEI 138

  Fly   297 IGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQI 335
            .|.| |..:.|..|.|.|..|.: :|...|.||.|.|::
Zfish   139 TGLS-RPAQEGEDVTLTCTTSGS-KPAADIRWFRNDKEV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 24/100 (24%)
V-set 204..290 CDD:284989 23/96 (24%)
cadm2bXP_005157530.1 Ig 35..129 CDD:299845 26/108 (24%)
IG_like 39..129 CDD:214653 24/100 (24%)
Ig 151..230 CDD:299845 10/26 (38%)
I-set 234..320 CDD:254352
IGc2 247..310 CDD:197706
4.1m 363..381 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.