DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and cadm1a

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001107023.2 Gene:cadm1a / 569931 ZFINID:ZDB-GENE-080505-2 Length:446 Species:Danio rerio


Alignment Length:373 Identity:75/373 - (20%)
Similarity:112/373 - (30%) Gaps:167/373 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTV----DQTTF-- 239
            ||.:..|     |.|..:::.  |..|.:.|.||.           .|..::.:    .||.:  
Zfish    36 PVQSQNL-----ISDNVSVVE--GETATISCRVKN-----------NDDSVIQLLNPNRQTIYFK 82

  Fly   240 ----IADQRFQSV-FSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGE 299
                :.|.|||.| ||.|..|.||  ..|.|.|||.|.||:.|:|...|...:.::.|....|.|
Zfish    83 DVRPLKDARFQLVNFSDNELRVSL--SNVSLSDEGRYVCQLYTDPPQEAYADITVLIPPGNPIIE 145

  Fly   300 STRH-VKAGSQVKLRCIISQALEPPLFINWFYNQKQI---------------------------- 335
            |... |..|::.::.| .|...:|...|.|....|::                            
Zfish   146 SREDIVSEGNETEITC-TSMGSKPAATIRWMKGDKELQGKSKVELTYDKMFTVTSWLRLTVTRED 209

  Fly   336 ---------------------YLH-----------------NRRGWRTEIERI------------ 350
                                 ||.                 .|.|...|:..:            
Zfish   210 DGVPVVCIVDHPAVKDFQAQKYLEVQYKPEVQIVVDFPSGPIREGENLELTCLAKGKPEPQQVNW 274

  Fly   351 -----DLPAEVPTTST--------------------------------------TTTTTTTTAST 372
                 |:|:....|.:                                      |||...||.:|
Zfish   275 VRVDDDVPSHAVITGSDLFIENLNKSYNGTYRCVASNPLGEAYDDYILFVRDALTTTPIPTTTTT 339

  Fly   373 TTTTTSTTP------ATPSTTATG--STEGATSSETLN-----GLVTI 407
            ||.:.:|:|      |.|||.|..  |..||.:..:::     |:|.:
Zfish   340 TTISATTSPPDVIQDAAPSTEAAAHDSQAGAETQRSMDHALIGGVVAV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 30/102 (29%)
V-set 204..290 CDD:284989 30/96 (31%)
cadm1aNP_001107023.2 Ig 41..135 CDD:299845 33/113 (29%)
IG_like 46..135 CDD:214653 30/103 (29%)
Ig 156..237 CDD:299845 8/81 (10%)
Ig_3 243..311 CDD:290638 6/67 (9%)
IG_like 247..324 CDD:214653 6/76 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.