DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and lrrn1

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001124166.1 Gene:lrrn1 / 568527 ZFINID:ZDB-GENE-071126-1 Length:717 Species:Danio rerio


Alignment Length:187 Identity:38/187 - (20%)
Similarity:68/187 - (36%) Gaps:32/187 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 SLQIKYVQLKDEGTYECQV-STEPKASAIVHLRI---VEPKTELIGESTRHVKAGSQVKLRCIIS 317
            :|:|.|:|:.|.|.|.|.. :||...:.:..:|:   :...|:|:....:|.::.|         
Zfish   484 TLRISYIQVDDSGHYTCVAQNTEGADTRVTAIRVNGTLLDSTQLMKIYVKHTESHS--------- 539

  Fly   318 QALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPA 382
                  :.::|..| ..:...|.: |.:...:||.|      ..|.|............|...||
Zfish   540 ------ILVSWKVN-SNVMTSNLK-WSSATMKIDNP------HITYTAKVPVDVHEYNLTHLQPA 590

  Fly   383 TPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTA 439
            |........:.  ...:|....|.:|..:...|:   ::||.|....:|....|..|
Zfish   591 TEYEVCLSVSN--IHQQTQKSCVNVTTKHATFAV---EISEQGTNTALAAVMGTILA 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 10/32 (31%)
V-set 204..290 CDD:284989 11/36 (31%)
lrrn1NP_001124166.1 leucine-rich repeat 55..74 CDD:275380
LRR_RI 86..>276 CDD:238064
LRR_8 97..156 CDD:290566
leucine-rich repeat 98..121 CDD:275380
leucine-rich repeat 122..145 CDD:275380
leucine-rich repeat 146..169 CDD:275380
leucine-rich repeat 170..193 CDD:275380
leucine-rich repeat 194..217 CDD:275380
LRR_8 216..276 CDD:290566
leucine-rich repeat 218..241 CDD:275380
LRR_RI 242..401 CDD:238064
leucine-rich repeat 242..265 CDD:275380
LRR_8 264..324 CDD:290566
leucine-rich repeat 266..289 CDD:275380
leucine-rich repeat 290..314 CDD:275380
LRR_8 313..374 CDD:290566
leucine-rich repeat 315..337 CDD:275380
leucine-rich repeat 340..353 CDD:275378
leucine-rich repeat 364..376 CDD:275378
LRRCT 372..414 CDD:214507
IG_like 433..517 CDD:214653 10/32 (31%)
Ig 441..517 CDD:299845 10/32 (31%)
FN3 532..601 CDD:214495 15/91 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.