Sequence 1: | NP_001287299.1 | Gene: | dpr15 / 41473 | FlyBaseID: | FBgn0037993 | Length: | 662 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_696022.6 | Gene: | aebp1b / 567630 | ZFINID: | ZDB-GENE-030131-8546 | Length: | 1247 | Species: | Danio rerio |
Alignment Length: | 233 | Identity: | 54/233 - (23%) |
---|---|---|---|
Similarity: | 81/233 - (34%) | Gaps: | 78/233 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 PPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPE 254
Fly 255 RWSLQIKYVQLKDEGTYECQVST--EPKASAIVHLRIV--------------------------- 290
Fly 291 ------EPKTELIGESTRHVK---AGSQVKLRCIISQALEP----PLFINWFYNQKQIYLHNRRG 342
Fly 343 WRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTT 380 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr15 | NP_001287299.1 | IG_like | 197..289 | CDD:214653 | 26/93 (28%) |
V-set | 204..290 | CDD:284989 | 24/87 (28%) | ||
aebp1b | XP_696022.6 | Ig | 56..147 | CDD:299845 | 29/100 (29%) |
IG_like | 62..145 | CDD:214653 | 28/98 (29%) | ||
FA58C | 402..555 | CDD:238014 | |||
FA58C | 403..556 | CDD:214572 | |||
Peptidase_M14_like | 577..1036 | CDD:299699 | |||
Peptidase_M14NE-CP-C_like | 1040..1115 | CDD:200604 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |