DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and aebp1b

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:233 Identity:54/233 - (23%)
Similarity:81/233 - (34%) Gaps:78/233 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPE 254
            ||    |.||  :.|.|..|.|.|....|. |:|:......:||......:  ....||.|    
Zfish    62 PP----YATI--EVGQHKQLLCKVSSDAKN-INWVSPNGEKVLTKHGNLKV--HNHGSVLS---- 113

  Fly   255 RWSLQIKYVQLKDEGTYECQVST--EPKASAIVHLRIV--------------------------- 290
              ||.:....|.:.|.|:| |:|  :.::.|.|.|.|:                           
Zfish   114 --SLTVLNANLNNAGIYKC-VATNGDTESQATVKLDIILKRMRRDTDRKGREKRLKEPKPSKKPK 175

  Fly   291 ------EPKTELIGESTRHVK---AGSQVKLRCIISQALEP----PLFINWFYNQKQIYLHNRRG 342
                  :||:|..|:..:..|   ..::.:...:.:..:.|    |:....||:.:.     .:.
Zfish   176 ASKPTKKPKSEKKGKGEKGGKKKGKKNREESTTVATTTVAPTTTVPMEYEEFYDPEP-----DQY 235

  Fly   343 WRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTT 380
            |..     |.|||          |||.|.||||.|..|
Zfish   236 WDE-----DFPAE----------TTTVARTTTTPTEKT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/93 (28%)
V-set 204..290 CDD:284989 24/87 (28%)
aebp1bXP_696022.6 Ig 56..147 CDD:299845 29/100 (29%)
IG_like 62..145 CDD:214653 28/98 (29%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.