DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and cadm1b

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001107024.1 Gene:cadm1b / 562183 ZFINID:ZDB-GENE-080327-34 Length:411 Species:Danio rerio


Alignment Length:492 Identity:101/492 - (20%)
Similarity:153/492 - (31%) Gaps:168/492 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 TTTLKPPPTIDDYQTIISQAGTHAYLPCNVK-------QLVKKPISWLRMRDGHILTVDQTTFIA 241
            ||.::....:.:..:::.  |..|.:.|.||       ||:......:..||...|        .
Zfish    39 TTPVQGQNLVTNNVSVVE--GETAIISCRVKNNDDSVIQLLNPNRQTIYFRDVRPL--------K 93

  Fly   242 DQRFQSV-FSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRH-V 304
            |.|||.| ||.|  ...:.:..|.|.|||.|.||:.|:|...|...:.::.|....|.||... |
Zfish    94 DSRFQLVNFSDN--ELLVSLSNVSLSDEGRYVCQLYTDPPQEAYADITVLVPPGNPILESREEIV 156

  Fly   305 KAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTT 369
            ..|::.::.| .:...:|...|.|.           :|        |.|.:              
Zfish   157 SEGNETEITC-TAMGSKPASTIKWM-----------KG--------DQPLQ-------------- 187

  Fly   370 ASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAV-- 432
                                |.   ||..|..:.:.|:|....|....::|        ||||  
Zfish   188 --------------------GE---ATVEELYDRMFTVTSRLRLTVSKEDD--------GVAVIC 221

  Fly   433 -----ATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTS 492
                 |.:...||...||:               .........|...|:|  ..|::........
Zfish   222 IIDHPAVKDFQAQKYLEVQ---------------YKPEVKIVVGFPEGLT--REGENLELTCKAK 269

  Fly   493 A--------WLTTMDAEAATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSN-- 547
            .        ||...|.             .||.:.   :|.:.|.|..:.|..:|.|.|..||  
Zfish   270 GKPQPHQINWLKVDDD-------------FPSHAL---VTGSDLFIENLNKSYNGTYRCVASNLV 318

  Fly   548 -SAPRTIVLHVLNGEYSAS------AIKSGSVSWSALIGCHGYLHWRNVSTLLTLLWIIKFALAR 605
             .|....:|:|.:.....:      |:..|.|   |::          |..:|.||.::....||
Zfish   319 GEAYDDYILYVYDSRADGAPQKIDHAVIGGVV---AVV----------VFAMLCLLIVLGRYFAR 370

  Fly   606 DICQPNATSKATTRTSLLRAGDGA----TADVTRETG 638
                    .|.|..|...:..|.|    ||.:..|.|
Zfish   371 --------HKGTYFTHEAKGADDAADADTAIINAEGG 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 29/99 (29%)
V-set 204..290 CDD:284989 29/93 (31%)
cadm1bNP_001107024.1 Ig1_Necl-2 46..140 CDD:143289 29/105 (28%)
IG_like 51..140 CDD:214653 29/100 (29%)
Ig 161..242 CDD:299845 24/160 (15%)
Ig_3 242..316 CDD:290638 16/91 (18%)
IG_like 252..329 CDD:214653 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.