DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and lrit3a

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001122166.1 Gene:lrit3a / 558559 ZFINID:ZDB-GENE-080723-63 Length:636 Species:Danio rerio


Alignment Length:297 Identity:65/297 - (21%)
Similarity:98/297 - (32%) Gaps:84/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 PTIDDYQT-IISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPE 254
            ||:....| |.|..|::..|.|:........:.| ...||.::   ..|.:.:...:.|      
Zfish   252 PTVMTSATKITSPLGSNVLLRCDANGFPTPTLLW-TTADGSVV---NNTVVQESPGEGV------ 306

  Fly   255 RWS-LQIKYVQLKDEGTYECQV-STEPKASAIVHLRI--VEPKTELIGESTRHVKAGSQVKLRCI 315
            ||| |.:..:..||.|.|.|:. :....|.|.:.|.:  |:|.|..                   
Zfish   307 RWSILSLHSIVFKDAGDYRCKAKNVAGNAEAYITLSVDGVQPTTPF------------------- 352

  Fly   316 ISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTT----TTTTASTTTTT 376
                  ||:.|.     ||                  |.:.|||:.|.|.    |:.:..|.||.
Zfish   353 ------PPINIT-----KQ------------------PEDQPTTTFTPTKMPLFTSLSPITITTR 388

  Fly   377 TSTTPATPSTTATGSTEG-------------ATSSETLNGLVTITRSYILDAISQNDVSE----L 424
            ...|...|.||......|             |...::.||..:|.:|.|.|.....:.:|    |
Zfish   389 PVMTTMPPLTTRKSPIPGGGVQRSPPAGDKPAKVQQSKNGKGSIKKSDIRDIEVVEETTETAVLL 453

  Fly   425 GAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLL 461
            .:|.|:...|..:......:.:....|..|..|.|.|
Zfish   454 WSAEGLPSDTPLTVVYFPYDAKDDKETVDTEVGQGKL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 23/94 (24%)
V-set 204..290 CDD:284989 20/89 (22%)
lrit3aNP_001122166.1 LRR_8 81..141 CDD:290566
leucine-rich repeat 83..106 CDD:275378
LRR_4 107..145 CDD:289563
leucine-rich repeat 107..130 CDD:275378
LRR_8 129..>171 CDD:290566
LRR_4 129..170 CDD:289563
leucine-rich repeat 131..154 CDD:275378
leucine-rich repeat 155..168 CDD:275378
TPKR_C2 199..249 CDD:301599
Ig 252..343 CDD:299845 25/100 (25%)
IG_like 261..343 CDD:214653 22/91 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.