DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and ptk7a

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001018501.1 Gene:ptk7a / 553690 ZFINID:ZDB-GENE-050522-216 Length:231 Species:Danio rerio


Alignment Length:192 Identity:45/192 - (23%)
Similarity:67/192 - (34%) Gaps:53/192 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 TRRTTRRPVATTTLKPPPTIDDYQTIISQA----------------GTHAYLPCNVKQLVKKPIS 222
            |||..|:..:...:....|:.. :.|::||                |..|.|.|.|........:
Zfish     5 TRRRGRKLASAENVLLALTLIG-EVIMAQAASFYFTKAPKSQDALHGRSAMLRCEVNDPQGVSYA 68

  Fly   223 WL-----------RMRDGHIL---TVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYEC 273
            |:           |..||..|   .:|:|  :....||.:.|.|...          ::|.|.|.
Zfish    69 WIQNGEPVTNSERRFLDGGNLKFTAIDRT--LDSGNFQCIASKNSTG----------EEERTAET 121

  Fly   274 QVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQI 335
            ..:.:...|..|.|:  .|      ||...:::.|||.|||.|.....|.  ..||.:..||
Zfish   122 SFNIKWLESGAVSLK--SP------ESVAEIQSSSQVILRCNIDGHPRPT--NRWFKDGTQI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 25/121 (21%)
V-set 204..290 CDD:284989 22/99 (22%)
ptk7aNP_001018501.1 I-set 37..120 CDD:254352 18/94 (19%)
Ig 42..122 CDD:299845 19/91 (21%)
Ig 150..222 CDD:299845 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.