DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and iglon5

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:402 Identity:86/402 - (21%)
Similarity:134/402 - (33%) Gaps:124/402 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 SQAGTHAYLPCNVKQLVKKPI-------------SWLRMRDGHILTVDQTTFIADQRFQSVFSPN 252
            :||....:||.|:..|..:.:             :||..  .:||......:..|.|. |:.:.|
Zfish    24 AQAAEFGHLPDNITVLEGESVVLRCKIDEEVTHKAWLNR--SNILFTGTDKWSLDSRV-SLENNN 85

  Fly   253 PERWSLQIKYVQLKDEGTYEC--QVSTEPKASAIVHLRIVEPKTELIGES-TRHVKAGSQVKLRC 314
            ...:|::|:.|.:.|||.|.|  |...:|: :|.|:| ||:....::..| .:.|..|..|.|.|
Zfish    86 NSDFSIRIERVMVADEGPYTCSFQARNKPR-TAHVYL-IVQVPARIVNISQDKSVNEGEDVNLFC 148

  Fly   315 IISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTST 379
            :.....||.  |.|    |..    :.|...|.|.:::          |......|......|:.
Zfish   149 LAVGRPEPT--ITW----KDF----KYGLLNEGEFLEI----------TEIKRHQAEDFECITNN 193

  Fly   380 TPATPSTTATGSTEGATSSETLNGLVTITRSY--ILDAISQNDVSELGAAAGVAVATETSTAQLL 442
            ..|.|.|..                |.:|.:|  |:     .||..:.|..|       .||.|.
Zfish   194 GVAPPDTRK----------------VKVTVNYPPII-----TDVKNMPAQVG-------KTAILR 230

  Fly   443 TEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAATTAA 507
            .|                                         |.|..|:::....|......:.
Zfish   231 CE-----------------------------------------AMAVPTASFEWYRDDRRPVESD 254

  Fly   508 TTTTTMLPSSSFIKQITTASLII-PAVVKLDSGNYTCSPSN---SAPRTIVLHVLNGEYSASAIK 568
            .|..        ||...|.||:: ..|.:...|||||..||   ::..:::|......|..:|..
Zfish   255 NTLK--------IKNEKTRSLLLFTNVTEKHFGNYTCFASNRLGASNASMLLFRPGAVYGGAASL 311

  Fly   569 SGSVSWSALIGC 580
            :|.:|...|..|
Zfish   312 NGRLSGVGLWFC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 27/102 (26%)
V-set 204..290 CDD:284989 25/100 (25%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 24/94 (26%)
Ig 35..123 CDD:299845 23/92 (25%)
Ig 125..>183 CDD:299845 15/77 (19%)
I-set 128..207 CDD:254352 21/114 (18%)
IG_like 217..298 CDD:214653 24/136 (18%)
ig 223..296 CDD:278476 23/128 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.