DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and dpr12

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:269 Identity:82/269 - (30%)
Similarity:126/269 - (46%) Gaps:53/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 PTIDD-----YQTIISQAGTHAYLPCNVKQLVK-----KPISWLRMRDGHILTVDQTTFIADQRF 245
            |..:|     :.|.:...|| |:|.|.|..:.:     ..|||:|.||.|||:.....:..|:||
  Fly    75 PMFEDSELMAHNTTVQLGGT-AFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERF 138

  Fly   246 QSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKA--SAIVHLRIVEPKTELIGESTRHVKAGS 308
            ..:.:|....|:||||:||.:|.|.||||||| |..  |..|:|::|.|:..::|....||..||
  Fly   139 AILHTPGSNMWTLQIKFVQRRDHGMYECQVST-PTGIISHFVNLQVVVPEAFILGSGELHVDMGS 202

  Fly   309 QVKLRCIISQALEPPLFINWFYNQKQI-YLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTAST 372
            .:.|.|||.::..||.::.|..|.:.| |:.:||         |:..|       ||....|.|.
  Fly   203 TINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRR---------DITIE-------TTPGPRTQSR 251

  Fly   373 TTTTTSTTPATPSTTATGS-TEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATET 436
            ...      ..|..|.:|: |..|:::|..:..|.:::...:.|||:.               :|
  Fly   252 LII------REPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRR---------------KT 295

  Fly   437 STAQLLTEV 445
            |:|..||.:
  Fly   296 SSADRLTHI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 40/98 (41%)
V-set 204..290 CDD:284989 39/92 (42%)
dpr12NP_652462.3 IG 86..183 CDD:214652 40/98 (41%)
Ig_3 193..271 CDD:404760 27/99 (27%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.