DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and NCAM1

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:387 Identity:88/387 - (22%)
Similarity:135/387 - (34%) Gaps:107/387 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPTIDDYQTII---SQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSP 251
            ||||...|.|:   :..|....|.|:.:...:..:||  .:||..:..::.    |:::  :||.
Human   211 PPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSW--TKDGEQIEQEED----DEKY--IFSD 267

  Fly   252 NPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCII 316
            :..:  |.||.|...||..|.|                       |.|:    |||.|       
Human   268 DSSQ--LTIKKVDKNDEAEYIC-----------------------IAEN----KAGEQ------- 296

  Fly   317 SQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEV---PTTSTTTTTTTTTASTTTTTTS 378
                :..:.:..|...|..|:.|:.....| |::.|..|.   |..|.|..|:|...|:....:.
Human   297 ----DATIHLKVFAKPKITYVENQTAMELE-EQVTLTCEASGDPIPSITWRTSTRNISSEEKASW 356

  Fly   379 TTPA-----TPSTTATGSTEGATSS-------ETLNGLVTI-----TRSYILDAISQNDVSELGA 426
            |.|.     .|.....|..:|...|       |||:|.:.:     ..|..|.:|...|..|...
Human   357 TRPEKQEVHAPWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSHARVSSLTLKSIQYTDAGEYIC 421

  Fly   427 AAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYA-AGAAAGITTAATGDSAATAAT 490
            .|...:..::.:..|  ||:......|          ..|.|. .|....||.    :..|..:.
Human   422 TASNTIGQDSQSMYL--EVQYAPKLQG----------PVAVYTWEGNQVNITC----EVFAYPSA 470

  Fly   491 TSAWLTTMDAEAATTAATTTTTMLPSSSF--IKQITTAS---LIIPAVVKLDSGNYTCSPSN 547
            |.:|.  .|.:           :||||::  ||...|.|   |.:....:.|.|||.|:..|
Human   471 TISWF--RDGQ-----------LLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVN 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 20/94 (21%)
V-set 204..290 CDD:284989 18/85 (21%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig 211..307 CDD:325142 31/143 (22%)
Ig 306..438 CDD:325142 30/134 (22%)
Ig_3 447..519 CDD:316449 23/88 (26%)
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.