DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and MUSK

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_005252051.1 Gene:MUSK / 4593 HGNCID:7525 Length:879 Species:Homo sapiens


Alignment Length:322 Identity:63/322 - (19%)
Similarity:100/322 - (31%) Gaps:111/322 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AFQRTQSRREALIPATTQMAQTLDKASAFRPTMAAALDAAAPNRSS---NNVAIN------NISN 96
            ||..|:...:|  |..|...:|:|.......|...|:::......|   |.:.|.      :|..
Human    17 AFSGTEKLPKA--PVITTPLETVDALVEEVATFMCAVESYPQPEISWTRNKILIKLFDTRYSIRE 79

  Fly    97 NGDQRLRLTAALEANLIMSNRNVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIPIGVAPATTT 161
            || |.|.:.:..::          :...|..|.:|..        |.|.....::.:.:.|    
Human    80 NG-QLLTILSVEDS----------DDGIYCCTANNGV--------GGAVESCGALQVKMKP---- 121

  Fly   162 TIDPATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLR- 225
                          :.||.|:....::               |..|.|||......|..:||:: 
Human   122 --------------KITRPPINVKIIE---------------GLKAVLPCTTMGNPKPSVSWIKG 157

  Fly   226 ---MRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYEC-------------- 273
               :|:...:.|                  .|..||:|..||.:|.|.|.|              
Human   158 DSPLRENSRIAV------------------LESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKVV 204

  Fly   274 ----QVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYN 331
                :..:||:....|..||      |....:.:|..||.|.|.|..:....|.  |.|..|
Human   205 KLEVEEESEPEQDTKVFARI------LRAPESHNVTFGSFVTLHCTATGIPVPT--ITWIEN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 23/113 (20%)
V-set 204..290 CDD:284989 24/107 (22%)
MUSKXP_005252051.1 I-set 28..117 CDD:254352 19/107 (18%)
Ig 36..117 CDD:299845 17/99 (17%)
I-set 121..203 CDD:254352 24/132 (18%)
Ig 135..201 CDD:299845 20/83 (24%)
I-set 223..306 CDD:254352 13/44 (30%)
Ig 239..306 CDD:143165 7/22 (32%)
CRD_FZ 325..467 CDD:295308
PTKc_Musk 579..868 CDD:133181
Pkinase_Tyr 585..866 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.