DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP001048

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_001231126.3 Gene:AgaP_AGAP001048 / 4576145 VectorBaseID:AGAP001048 Length:416 Species:Anopheles gambiae


Alignment Length:150 Identity:31/150 - (20%)
Similarity:55/150 - (36%) Gaps:24/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PPPTI--DDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSP 251
            ||..|  |....:|...|:...|.|..|...:..::| |..||      ....:.|........|
Mosquito    51 PPDFISEDTSSDVIVPEGSSVKLTCRAKGYPEPIVTW-RREDG------TDIILKDAAGSKQIVP 108

  Fly   252 NPERWSLQIKYVQLKDEGTYEC------QVSTEPKASAIVHLR-IVEPKTELIGESTRHVKAGSQ 309
            :.....|::..:...:.|:|.|      ..|...:.|..:|.. :::...:|:|     ...|:.
Mosquito   109 SYRGEVLKLSKISRSEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVG-----APLGTD 168

  Fly   310 VKLRCIISQALEPPLFINWF 329
            |.:.|.|..:   |..||::
Mosquito   169 VTIECQIEAS---PKSINYW 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 18/98 (18%)
V-set 204..290 CDD:284989 17/92 (18%)
AgaP_AGAP001048XP_001231126.3 I-set 52..148 CDD:254352 20/102 (20%)
IGc2 67..136 CDD:197706 14/75 (19%)
Ig 152..245 CDD:299845 9/41 (22%)
I-set 152..245 CDD:254352 9/41 (22%)
Trp-synth-beta_II <326..>380 CDD:294246
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.