DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and opcml

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:346 Identity:83/346 - (23%)
Similarity:127/346 - (36%) Gaps:79/346 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PPPTIDDY--QTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSP 251
            |..:.|.|  ..|..:.|..|.|.|::...|.: ::||          ::||.:        |:.
Zfish    30 PARSGDSYLKDNITVRQGDSAVLKCSMDNKVSR-VAWL----------NRTTIL--------FTG 75

  Fly   252 NPERWSL----------------QIKYVQLKDEGTYECQVSTEPK-ASAIVHLRIVEPKTELIGE 299
            | |:|||                :|..|.|.|||.|.|.:.|..| .|..||| ||:....::..
Zfish    76 N-EKWSLDPRVVLLNTAVNEYSIKILNVNLYDEGPYVCSILTNKKPESTKVHL-IVQVPARIVNV 138

  Fly   300 STR-HVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWR--TEIERIDLPAEVPTTS- 360
            ||. .|..||.|.|.|:.....||.:.  |.:       .:.:|.|  ||.|.:::.......| 
Zfish   139 STDVSVNEGSNVSLMCLAIGRPEPSIL--WKF-------RSSKGNRIVTEGEYVEMTGITKDMSG 194

  Fly   361 -----TTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQND 420
                 |:...:.....|...|.:..|......:||:..|.      .|::....|.:..|..|..
Zfish   195 SYDCITSNDISPPDVRTVQVTVNYPPVISRARSTGTAVGQ------KGVLWCEASAVPLADFQWF 253

  Fly   421 VSE---LGAAAGVAVATETSTAQLLTEVEATSSTSG--TSTGAGLLASTSAA---YAAGAAAGIT 477
            ..|   |....||.:..: ....:||....:....|  |......|..|:|:   |..||...: 
Zfish   254 KGERRILNGFNGVKIENK-GKQSMLTFFNVSEEDYGNYTCVAINTLGITNASIILYGPGAIHDV- 316

  Fly   478 TAATGDSAATAATTSAWLTTM 498
                 ::||.:.|.|..|.|:
Zfish   317 -----NNAALSPTCSLLLLTL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 30/108 (28%)
V-set 204..290 CDD:284989 29/102 (28%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 30/108 (28%)
IG_like 41..129 CDD:214653 30/108 (28%)
IG_like 139..216 CDD:214653 19/85 (22%)
IGc2 146..202 CDD:197706 15/64 (23%)
I-set 219..307 CDD:254352 19/94 (20%)
ig 223..307 CDD:278476 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.