DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and negr1

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:409 Identity:83/409 - (20%)
Similarity:134/409 - (32%) Gaps:126/409 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IPATTQMAQTLDKASAFRPTMAAALDAAA--------------PNRSSNNVAINNISNNGDQRLR 103
            :|:.....||:|..::....::...|.|.              .|||| .:...|...:||.|:.
Zfish    28 LPSCLPAGQTVDYTTSSESVVSRQGDTALLRCYLLDGISKGAWLNRSS-IIYAGNDKWSGDPRVS 91

  Fly   104 LTAALEANLIMSNRNVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIPIGVAPATTTTIDPATT 168
            :.:           ||.::|.|                        |:.|.....|    |....
Zfish    92 IVS-----------NVGDKHEY------------------------SLQIQKVDVT----DEGVY 117

  Fly   169 TPTTTTRRTTRRPVATTTLKPPPTIDDYQTIIS-QAGTHAYLPCNVKQLVKKPISWLRMRDGHIL 232
            |.:..:.|.....:....:|.||.|.|..:.|: ..|::..|.|......:..|||     .|| 
Zfish   118 TCSIQSERNLHPKLIQLIVKVPPKIYDISSDITVNEGSNVSLICAASGKPEPKISW-----RHI- 176

  Fly   233 TVDQTTFIADQRFQSVFSPNPERWS----LQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPK 293
                             ||:..::.    |.|..:.....|.|||....:..:.....:|:....
Zfish   177 -----------------SPSARKYESGEYLNITGISRDQAGDYECGAENDIASPDTKTVRVTVNF 224

  Fly   294 TELIGESTRH-VKAGSQVKLRCIISQALEPPLFINWFYNQKQIYL-------------------- 337
            ...|.|...| |:.|....||| .:.|:..|:| .|:..:|:|.:                    
Zfish   225 PPAIHEMKSHGVRPGQVALLRC-EAAAVPSPVF-EWYKGEKRINMGQGIVINNLSSRSVLTVKNM 287

  Fly   338 -HNRRGWRT--EIERIDLP-AEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSS 398
             .:|.|..|  .:.|:... |.||.......|||:..|        :||: :....|||.||.  
Zfish   288 TQDRYGNYTCVAVNRLGTANASVPLNPIIEPTTTSAVS--------SPAS-NPAMYGSTGGAE-- 341

  Fly   399 ETLNGLVTITRSYILDAIS 417
                  |.:...|::.|:|
Zfish   342 ------VLLACWYLILALS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 17/96 (18%)
V-set 204..290 CDD:284989 17/89 (19%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 19/118 (16%)
IG_like 44..136 CDD:214653 20/131 (15%)
I-set 140..222 CDD:254352 21/104 (20%)
IGc2 153..208 CDD:197706 16/77 (21%)
IG_like 236..312 CDD:214653 17/77 (22%)
IGc2 238..304 CDD:197706 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.