DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:455 Identity:92/455 - (20%)
Similarity:155/455 - (34%) Gaps:120/455 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 ATTTLKPPPT-IDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQ 246
            :::.|.|.|. |.....:...||..|.|.|:|:.|.|..:.|||..|..:|.:.......:.|. 
  Fly    31 SSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARI- 94

  Fly   247 SVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRH--VKAGSQ 309
            ||...:...|.|:|..::..|.|.|.||::|.|....:..:.:..|...:..||:..  |:.|..
  Fly    95 SVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGED 159

  Fly   310 VKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTT 374
            ..|.|..:...:|.  :.|.....::.|..:.|.| |:.::                        
  Fly   160 ATLTCKATGNPQPR--VTWRREDGEMILIRKPGSR-ELMKV------------------------ 197

  Fly   375 TTTSTTPATPSTTATGSTEGATSSETLNG----LVTITR----SYILDAISQNDVSELGAAAGVA 431
                                    |:.||    |:.:.|    :|:  .|:.|||..       |
  Fly   198 ------------------------ESYNGSSLRLLRLERRQMGAYL--CIASNDVPP-------A 229

  Fly   432 VATETS-TAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWL 495
            |:...| :.|....|.|.|...||..|:.:......                  .|:.:..|.||
  Fly   230 VSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQV------------------EASPSPVSYWL 276

  Fly   496 TTMDAEAATTAATTTTTMLPSSSFIKQIT-----------------TASLIIPAVVKLDSGNYTC 543
              ..|..:...|:.:|..|.|.|...::.                 ...|::.:....|.|.|.|
  Fly   277 --KGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHC 339

  Fly   544 SPSNSAPR---TIVLHVLNGEYSASAIKSGSVSW-------SALIGCHGYLHWRNVSTLLTLLWI 598
            ..:||..|   |:.|:.:.....|||.....:::       :...|......|:.:..:|.|||:
  Fly   340 VSTNSLGRAEGTLRLYEIKLHPGASASNDDHLNYIGGLEEAARNAGRSNRTTWQPLLAMLMLLWM 404

  Fly   599  598
              Fly   405  404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/91 (29%)
V-set 204..290 CDD:284989 25/85 (29%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 26/92 (28%)
Ig 47..129 CDD:299845 26/82 (32%)
Ig 140..238 CDD:299845 26/157 (17%)
IG_like 247..355 CDD:214653 23/127 (18%)
Ig 256..351 CDD:299845 19/114 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.