DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and klg

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:364 Identity:78/364 - (21%)
Similarity:127/364 - (34%) Gaps:94/364 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILLALLICLPAIRGQ---AEETSILNSNGTNGRAFQRTQSRREALIPATTQMAQTLDKASAFRP 71
            ||:::|...|.|..|.   |.|.:|.| .|:|.|:....|....|....|..:.:.|.:...:|.
  Fly    49 LIVISLGWLLHAHAGSGGFAVEAAISN-RGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRA 112

  Fly    72 TMAAALDAAAP-------------NRSSNNVAINNISNNGDQRLRLTAALEANLIMSNRNVQEQH 123
            .:...|  ..|             .|.:|.:..:||....|:|:||....  ||.:|:...|:..
  Fly   113 VVGDTL--VLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGY--NLEISDLEPQDAG 173

  Fly   124 SY------RITQDNATSAASIAPNGTAFGDAPSIPIGVAPATTTTIDPATTTPTTTTRRTTRRPV 182
            .|      :|.:|...:...:.|        ||:.   |..|:..:......|.|...:.:..||
  Fly   174 DYVCQISDKINRDQVHTVEILVP--------PSVR---AIPTSGQLQARKGGPITLECKGSGNPV 227

  Fly   183 ATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQS 247
                    |:|  |.|..|.|..                |..|:.||.|||:::           
  Fly   228 --------PSI--YWTKKSGANK----------------STARIGDGPILTLEK----------- 255

  Fly   248 VFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLR--IVEPKTELIGESTRHVKAGSQV 310
                           ::.:..|.|:|...........|.:|  ::.|....:.:|..|...|.:.
  Fly   256 ---------------LERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEA 305

  Fly   311 KLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIER 349
            ||.||:  ..:|...::|:.|...|...:||...|...|
  Fly   306 KLVCIV--FADPVATVSWYQNSFPIQSTDRRIMATRANR 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 15/93 (16%)
V-set 204..290 CDD:284989 12/87 (14%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 15/63 (24%)
IG_like 109..195 CDD:214653 18/89 (20%)
Ig 118..191 CDD:143165 17/76 (22%)
IG_like 205..274 CDD:214653 20/120 (17%)
IGc2 213..273 CDD:197706 20/111 (18%)
IGc2 301..367 CDD:197706 13/44 (30%)
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.