DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Btnl7

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_017457195.1 Gene:Btnl7 / 406159 RGDID:1303124 Length:547 Species:Rattus norvegicus


Alignment Length:212 Identity:45/212 - (21%)
Similarity:74/212 - (34%) Gaps:59/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IISQAGTHAYLPCNVKQLVK----KPISWLRMRDGHILTV--DQ--------------TTFIADQ 243
            :::..|..|.|||:|...:.    :.:.|.|.|....:.|  ||              |:.:.||
  Rat    40 VVAAPGREAILPCSVFPAMSVENMEELRWFRNRFSQAVFVYRDQEEQKEEQMIEYSWRTSLVKDQ 104

  Fly   244 RFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLR---IVEPKTELIGESTRHVK 305
            ..:.       :.:::|:.||..|.|.|.|.....       |.|   |:|.|...:|.......
  Rat   105 FHEG-------KAAVRIQNVQESDSGIYVCHFKHG-------HFREEAILELKVAAMGSVPEVYI 155

  Fly   306 AGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTT--------STT 362
            .|.:....|::...       :.:|.:.|::..:.||       .||||...|.        ||.
  Rat   156 KGPEDGGVCVVCMT-------SGWYPEPQVHWRDSRG-------EDLPASSETLHEDAEGLFSTE 206

  Fly   363 TTTTTTTASTTTTTTST 379
            .:.....:|....|.||
  Rat   207 NSLVVRDSSVRNVTCST 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 24/112 (21%)
V-set 204..290 CDD:284989 24/108 (22%)
Btnl7XP_017457195.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.