DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and LSAMP

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:283 Identity:70/283 - (24%)
Similarity:111/283 - (39%) Gaps:35/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYV 263
            |..:.|..|.|.|.|:....| ::||. |.| |:......:..|.|.: :...:...:||:|:.|
Human    41 ITVRQGDTAILRCVVEDKNSK-VAWLN-RSG-IIFAGHDKWSLDPRVE-LEKRHSLEYSLRIQKV 101

  Fly   264 QLKDEGTYECQVST--EPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFI 326
            .:.|||:|.|.|.|  |||.|.:..:..|.||...|..... |..||.|.|.|:.:...||  .|
Human   102 DVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVT-VNEGSNVTLVCMANGRPEP--VI 163

  Fly   327 NW---------FYNQKQIYLHNRRGWRTEIERIDLPA--EVPTTSTTTTTTTTTASTTTTTTSTT 380
            .|         |..::: ||......|.:..:.:..|  ||.:........|.....|.|.:.:.
Human   164 TWRHLTPTGREFEGEEE-YLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSN 227

  Fly   381 PATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAV-ATETSTAQLLTE 444
            .||....|:...|.:.....             |.....|.:.:.:|.|:.: :||..::..:|.
Human   228 EATTGRQASLKCEASAVPAP-------------DFEWYRDDTRINSANGLEIKSTEGQSSLTVTN 279

  Fly   445 VEATSSTSGTSTGAGLLASTSAA 467
            |......:.|...|..|..|:|:
Human   280 VTEEHYGNYTCVAANKLGVTNAS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 29/91 (32%)
V-set 204..290 CDD:284989 28/87 (32%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 29/90 (32%)
Ig 132..215 CDD:386229 20/86 (23%)
Ig_3 219..294 CDD:372822 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.