DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and rplp0

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_012813704.1 Gene:rplp0 / 394664 XenbaseID:XB-GENE-976211 Length:315 Species:Xenopus tropicalis


Alignment Length:165 Identity:38/165 - (23%)
Similarity:56/165 - (33%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EETSILNSNGTNGRAFQRTQSRREALIPATTQMAQTLDKASAFRPTMAAALDAAAPNRSSNNVAI 91
            |:||...:.|...:.     ||....|.:..|:.:|.||..|...|:...|:.:.   .|..:.|
 Frog   134 EKTSFFQALGITTKI-----SRGTIEILSDVQLIKTGDKVGASEATLLNMLNISP---FSYGLII 190

  Fly    92 NNISNNGD----QRLRLT-AALEANLIMSNRNVQE---QHSYRITQDNATSAAS----------- 137
            ..:.:||.    :.|.:| .||....:...|||..   |..|........|..:           
 Frog   191 QQVYDNGSIYSPEVLDITEEALHVRFLEGVRNVASVCLQIGYPTVASVPHSVINGYKRVLAIAVE 255

  Fly   138 ------IAPNGTAFGDAPSIPIGVAPATTTTIDPA 166
                  :|....||...||..:..|||......||
 Frog   256 TDYSFPLADKVKAFLADPSAFVVAAPAADVAAAPA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653
V-set 204..290 CDD:284989
rplp0XP_012813704.1 Ribosomal_L10_P0 <76..315 CDD:381979 38/165 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.