DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and dpr10

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:340 Identity:91/340 - (26%)
Similarity:126/340 - (37%) Gaps:93/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIK 261
            :.|.|..|..|||.|.||.|..|.::|:|.||.|||||...|:..|||||:.:..:.:.|:||||
  Fly    61 RNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIK 125

  Fly   262 YVQLKDEGTYECQVSTEPKASAIVHLRIVE----------------------------------- 291
            :.|.:|.|.||||:||:|..|..|:|.||:                                   
  Fly   126 WAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFA 190

  Fly   292 -----------PKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRT 345
                       |...::|....:|..||.:.|.|||..:.|||..|.| |:|.::......|.|.
  Fly   191 GMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFW-YHQDKVLSEETSGGRL 254

  Fly   346 EIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRS 410
            :.:.|        .|..|.:...........:......||.|...|                .|.
  Fly   255 KFKTI--------KSEETKSILLIYDADLLHSGKYSCYPSNTEIAS----------------IRV 295

  Fly   411 YILDAISQNDVSELGAAAGVAVA---------------TETSTAQLLTEVEATSSTSGTSTGAGL 460
            ::|.......:....|.|.||:|               ..|..|.|:. :||.||....|.|.| 
  Fly   296 HVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVL-LEACSSLLLQSGGGG- 358

  Fly   461 LASTSAAYAAGAAAG 475
                 .....|:.||
  Fly   359 -----GCPGGGSPAG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 44/91 (48%)
V-set 204..290 CDD:284989 42/85 (49%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 40/79 (51%)
IG_like 210..297 CDD:214653 24/111 (22%)
IGc2 217..287 CDD:197706 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444669
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.