DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and dscamb

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_009289749.1 Gene:dscamb / 386937 ZFINID:ZDB-GENE-031118-67 Length:2020 Species:Danio rerio


Alignment Length:505 Identity:98/505 - (19%)
Similarity:161/505 - (31%) Gaps:152/505 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LRLTAALEANLIMSNRNVQEQHSYRITQDNATSAAS-----IAPNGT-----AFGD---APSIPI 153
            :|:|.....||:|......:..:|:....|...:..     :..:||     ||.:   :|:.||
Zfish   360 VRITGINNENLVMEGMAKSDGGAYQCFARNGKMSTQDLVQVVLEDGTPKILSAFSEKVVSPNEPI 424

  Fly   154 GVA--------PATTTTIDPATTTPTTTTRR----TTRRPV------------------------ 182
            .:.        |..|.|:|.......:..|.    ||...|                        
Zfish   425 SLVCHVKGTPLPTVTWTLDDDPVIKDSNHRMDRIITTEGHVLSYLNVSHTQVSDGGVYRCTCNNS 489

  Fly   183 -------ATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFI 240
                   |...::.|.:|...:.:.:.||...|:.|.:.......|.|  .:|.::|..:..   
Zfish   490 AGSVSYQARINVRGPASIRPMKNVTAIAGRDTYIHCRIIGYPYYSIKW--YKDSNLLPFNHR--- 549

  Fly   241 ADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKAS--AIVHLRIVEPKTELIGES-TR 302
                 |..|..|   .:|::..||..|||.|.|.|..:|:..  ..||:.:..|  .||..| ::
Zfish   550 -----QRAFENN---GTLKLSNVQNSDEGEYTCYVLVDPEKQIHRSVHVTVKVP--PLIQHSDSQ 604

  Fly   303 HVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTT 367
            ....|.:|.:.|::... :.|:.|.|..:.:.|    .......|:.||.               
Zfish   605 SASIGQRVFIPCVVISG-DLPMSITWHKDGRPI----NASLGVTIDNIDF--------------- 649

  Fly   368 TTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAV 432
                                 |.|...:..||..||..|        .|::|:          |.
Zfish   650 ---------------------TSSLRISNLSEIHNGSYT--------CIARNE----------AA 675

  Fly   433 ATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTT 497
            |.|.| .||:.:|........        ......|  |.:..:..:|.|:...|.    .|..:
Zfish   676 AVEHS-IQLIVKVPPHFEVQP--------KDQDGIY--GKSVTLNCSAKGNPIPTI----VWNHS 725

  Fly   498 MDAEAATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSN 547
            ..|.........    |.|.|.::.:...||:|..|::.|:|.|.|..||
Zfish   726 KGAGVPQFQPIA----LNSGSRVQLLENGSLLIKHVLEEDAGFYLCKVSN 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 23/93 (25%)
V-set 204..290 CDD:284989 22/87 (25%)
dscambXP_009289749.1 I-set 132..198 CDD:254352
I-set 225..310 CDD:254352
IGc2 239..300 CDD:197706
IG_like 320..400 CDD:214653 7/39 (18%)
IGc2 328..391 CDD:197706 7/30 (23%)
IG_like 417..501 CDD:214653 12/83 (14%)
Ig 424..498 CDD:143165 9/73 (12%)
IG_like 511..592 CDD:214653 23/93 (25%)
IGc2 518..576 CDD:197706 18/70 (26%)
I-set 595..685 CDD:254352 29/151 (19%)
Ig 612..682 CDD:143165 22/129 (17%)
I-set 689..785 CDD:254352 20/101 (20%)
Ig7_DSCAM 706..785 CDD:143211 18/74 (24%)
IG_like 795..883 CDD:214653
Ig 803..890 CDD:299845
FN3 887..980 CDD:238020
FN3 987..1084 CDD:238020
FN3 1092..1185 CDD:238020
FN3 1190..1279 CDD:238020
IGc2 1302..1367 CDD:197706
FN3 1398..1471 CDD:238020
FN3 1485..1557 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.