DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and ImpL2

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:287 Identity:50/287 - (17%)
Similarity:95/287 - (33%) Gaps:62/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AKMPRRLILLALLI--CLPAIRGQA-----EETSILNS-----NGTNGRAFQRTQSRREALIPAT 56
            |||...:..||||:  .:..:||:|     :...:.||     .....|||:....:.....|..
  Fly     3 AKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTK 67

  Fly    57 TQMAQ--TLDKASAFRPTMAAALD---AAAPNRSSNNVAINNISNNGDQRLRLTAALEANLIMSN 116
            .|.|.  |::.......:...::.   ...|....:::..|.::......:              
  Fly    68 LQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAI-------------- 118

  Fly   117 RNVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIPIGVAPATTTTIDPATTTPTTTTRRTTRRP 181
            ..|:..|........|.:...:...|:....|.::   |.|..::.:.|..|.|..         
  Fly   119 VRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTV---VHPPRSSRLTPEKTYPGA--------- 171

  Fly   182 VATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQ 246
                  :.|..|...:|.:...|::..|||.|....:..|:||...:..|:...:...:|:    
  Fly   172 ------QKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLAN---- 226

  Fly   247 SVFSPNPERWSLQIKYVQLKDEGTYEC 273
                     ..|.|..::.:|.|.|:|
  Fly   227 ---------GDLLISEIKWEDMGNYKC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 17/77 (22%)
V-set 204..290 CDD:284989 16/70 (23%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.