| Sequence 1: | NP_001287299.1 | Gene: | dpr15 / 41473 | FlyBaseID: | FBgn0037993 | Length: | 662 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523891.2 | Gene: | Pxn / 38326 | FlyBaseID: | FBgn0011828 | Length: | 1527 | Species: | Drosophila melanogaster |
| Alignment Length: | 261 | Identity: | 60/261 - (22%) |
|---|---|---|---|
| Similarity: | 88/261 - (33%) | Gaps: | 87/261 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 97 NGDQRLRLTAALE----ANLIMSNRNVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIP-IGVA 156
Fly 157 PATTT-------------------TID--------PATTTPTTTTRRTTRRPVAT---------- 184
Fly 185 -------------TTLK------PPPTIDDYQTIISQAGTHAYLPCNVKQLVKKP-----ISWLR 225
Fly 226 MRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTE---PKASAIVHL 287
Fly 288 R 288 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr15 | NP_001287299.1 | IG_like | 197..289 | CDD:214653 | 30/100 (30%) |
| V-set | 204..290 | CDD:284989 | 30/93 (32%) | ||
| Pxn | NP_523891.2 | LRR_RI | 51..>161 | CDD:238064 | |
| leucine-rich repeat | 54..77 | CDD:275380 | |||
| LRR_8 | 55..112 | CDD:290566 | |||
| leucine-rich repeat | 78..101 | CDD:275380 | |||
| leucine-rich repeat | 102..125 | CDD:275380 | |||
| LRR_8 | 124..184 | CDD:290566 | |||
| leucine-rich repeat | 126..149 | CDD:275380 | |||
| LRR_4 | 148..185 | CDD:289563 | |||
| leucine-rich repeat | 150..173 | CDD:275380 | |||
| Ig | 240..325 | CDD:299845 | |||
| IG_like | 242..325 | CDD:214653 | |||
| I-set | 366..450 | CDD:254352 | 12/50 (24%) | ||
| Ig | 384..451 | CDD:143165 | 13/51 (25%) | ||
| I-set | 458..546 | CDD:254352 | 13/87 (15%) | ||
| Ig | 472..536 | CDD:299845 | 7/63 (11%) | ||
| I-set | 553..644 | CDD:254352 | 30/104 (29%) | ||
| Ig | 570..643 | CDD:299845 | 26/86 (30%) | ||
| An_peroxidase | 777..1317 | CDD:281139 | |||
| peroxidasin_like | 898..1338 | CDD:188658 | |||
| VWC | 1465..1523 | CDD:278520 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||