DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Pxn

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster


Alignment Length:261 Identity:60/261 - (22%)
Similarity:88/261 - (33%) Gaps:87/261 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 NGDQRLRLTAALE----ANLIMSNRNVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIP-IGVA 156
            ||.|.|:.|.:|:    .:||:...|.....:||....|:..:.    ..||..:...:| |..|
  Fly   403 NGRQLLQSTPSLQLQANGSLILLQPNQLSAGTYRCEARNSLGSV----QATARIELKELPEILTA 463

  Fly   157 PATTT-------------------TID--------PATTTPTTTTRRTTRRPVAT---------- 184
            |.:.|                   |||        |..|.........|...|..          
  Fly   464 PQSQTIKLGKAFVLECDADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYR 528

  Fly   185 -------------TTLK------PPPTIDDYQTIISQAGTHAYLPCNVKQLVKKP-----ISWLR 225
                         .|:|      ||....:...:::..||...|||...|    |     |||  
  Fly   529 CTAHNENGETSVEATIKVERSQSPPQLAIEPSNLVAITGTTIELPCQADQ----PEDGLQISW-- 587

  Fly   226 MRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTE---PKASAIVHL 287
            ..||.:  :|....:| :::|.     ....||.:|.|.:.|.|.||||:..:   ..|||:|.:
  Fly   588 RHDGRL--IDPNVQLA-EKYQI-----SGAGSLFVKNVTIPDGGRYECQLKNQFGRASASALVTI 644

  Fly   288 R 288
            |
  Fly   645 R 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 30/100 (30%)
V-set 204..290 CDD:284989 30/93 (32%)
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064
leucine-rich repeat 54..77 CDD:275380
LRR_8 55..112 CDD:290566
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
LRR_8 124..184 CDD:290566
leucine-rich repeat 126..149 CDD:275380
LRR_4 148..185 CDD:289563
leucine-rich repeat 150..173 CDD:275380
Ig 240..325 CDD:299845
IG_like 242..325 CDD:214653
I-set 366..450 CDD:254352 12/50 (24%)
Ig 384..451 CDD:143165 13/51 (25%)
I-set 458..546 CDD:254352 13/87 (15%)
Ig 472..536 CDD:299845 7/63 (11%)
I-set 553..644 CDD:254352 30/104 (29%)
Ig 570..643 CDD:299845 26/86 (30%)
An_peroxidase 777..1317 CDD:281139
peroxidasin_like 898..1338 CDD:188658
VWC 1465..1523 CDD:278520
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.